DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and Bhlhe41

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_038964817.1 Gene:Bhlhe41 / 117095 RGDID:70900 Length:410 Species:Rattus norvegicus


Alignment Length:359 Identity:89/359 - (24%)
Similarity:143/359 - (39%) Gaps:112/359 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDYKNDINSDDDFDCSNGYSDSYGSNGRMSNP-NGLSKAELRKTNK---PIMEKRRRARINHCLN 61
            :::::.|..|        ||..|     |..| ..|.:.:.:.|.|   .::||:||.|||.|:.
  Rat    14 LEHRDFIGLD--------YSSLY-----MCKPKRSLKRDDTKDTYKLPHRLIEKKRRDRINECIA 65

  Fly    62 ELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSV-----QRQQLNMAIQ----SDPSVVQ--- 114
            :||.|:.|.:|.....|  ||||.:||:|:|||:::     |:.|..:|:|    |..|.||   
  Rat    66 QLKDLLPEHLKLTTLGH--LEKAVVLELTLKHLKALTALTEQQHQKIIALQNGERSLKSPVQADL 128

  Fly   115 -KFKTGFVECAEEVNRYVSQMDGIDTGVRQ----RLSAHLNQCANSL------------------ 156
             .|.:||..||:||.:|:::.:....  |:    :|.:||:..|..|                  
  Rat   129 DAFHSGFQTCAKEVLQYLARFESWTP--REPRCAQLVSHLHAVATQLLTPQVTPGRGPGRAPCSA 191

  Fly   157 --------EQIGSM----------------SNFSNGYRGGLFPATAVTAAPTPLFPS-LPQDLNN 196
                    |::...                ::..:||.|......|......|..|| .|:.|..
  Rat   192 GAAAASGSERVARCVPVIQRTQPGTEPEHDTDTDSGYGGEAEQGRAAVKQEPPGDPSPAPKRLKL 256

  Fly   197 NSRTE--SSAPAIQMGGLQLIPSRLPSGE---------FALIMPNTGS----------------- 233
            .:|..  ...||: :|.|..:....|..:         |.|:.|:..:                 
  Rat   257 EARGALLGPEPAL-LGSLVALGGGAPFAQPAAAPFCLPFYLLSPSAAAYVQPWLDKSGLDKYLYP 320

  Fly   234 AAPPPGPFAWPG--SAAGVAAGTASAALASIANP 265
            ||..|.|..:||  :||..||..|...|:|:.:|
  Rat   321 AAAAPFPLLYPGIPAAAAAAAAAAFPCLSSVLSP 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 27/69 (39%)
ORANGE 114..158 CDD:128787 15/77 (19%)
Bhlhe41XP_038964817.1 bHLH-O_DEC2 31..122 CDD:381593 33/92 (36%)
ORANGE 129..175 CDD:128787 14/47 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.