DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpn and hes6.1

DIOPT Version :9

Sequence 1:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_017949954.1 Gene:hes6.1 / 100126814 XenbaseID:XB-GENE-1018104 Length:195 Species:Xenopus tropicalis


Alignment Length:105 Identity:37/105 - (35%)
Similarity:61/105 - (58%) Gaps:5/105 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQRQQLNMAIQSD 109
            ||::|||||||||..|.:|:.::     .|....:|:|.|::||:|||.::.:.|.:...|.:..
 Frog    18 KPLVEKRRRARINESLQDLRGIL-----SDTEFQSKMENAEVLELTVKRVERILRNRTAEADRLQ 77

  Fly   110 PSVVQKFKTGFVECAEEVNRYVSQMDGIDTGVRQRLSAHL 149
            ....::|..|:::|..||:.:||...|||..:...|..||
 Frog    78 REASERFAAGYIQCMHEVHTFVSSCPGIDASLAAELLNHL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpnNP_476923.1 HLH 39..101 CDD:238036 23/55 (42%)
ORANGE 114..158 CDD:128787 13/36 (36%)
hes6.1XP_017949954.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.