DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14757 and SDH5

DIOPT Version :9

Sequence 1:NP_610363.1 Gene:CG14757 / 35797 FlyBaseID:FBgn0033274 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_014570.1 Gene:SDH5 / 854083 SGDID:S000005432 Length:162 Species:Saccharomyces cerevisiae


Alignment Length:176 Identity:63/176 - (35%)
Similarity:96/176 - (54%) Gaps:34/176 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLRQLRLTMDISGWIFL-------PW---RRSMSNMKDSPPPPPPLASTFNDVIVDYEDPDYLPL 55
            |...|..|:.:.|:..:       .|   ||..|:.||.          .:||:...:   ..|:
Yeast     4 MFPALTKTLSLQGYKIINSQTGSAAWSCGRRWFSSDKDD----------HDDVVTRIK---IAPI 55

  Fly    56 PEYPVRPNEPLETRKQRLLYQSRKRGMLENDLLLSTFAAKHLQNFSAEQTAQYDQLINGVSNDWD 120
            .    |.||||:.::.||:|||||||:||.|||||.||||:|:..:.|:..:||.|:|.:  |||
Yeast    56 K----RTNEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNEL--DWD 114

  Fly   121 IYYWAT---EVKPTPKEY-DTEIMGLLKEHVKNAERVTRLRQPDLN 162
            ||||||   :..|.|.:: :::::..|:|..:|.|:.. |..|||:
Yeast   115 IYYWATKNFKTSPLPDKWANSKLLKQLQEFSENKEKEI-LSMPDLS 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14757NP_610363.1 Sdh5 70..143 CDD:281870 37/76 (49%)
SDH5NP_014570.1 SdhE 52..150 CDD:225489 46/103 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341956
Domainoid 1 1.000 79 1.000 Domainoid score I2044
eggNOG 1 0.900 - - E1_COG2938
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32370
Inparanoid 1 1.050 96 1.000 Inparanoid score I1493
Isobase 1 0.950 - 0 Normalized mean entropy S1158
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003243
OrthoInspector 1 1.000 - - otm46674
orthoMCL 1 0.900 - - OOG6_102226
Panther 1 1.100 - - LDO PTHR12469
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1299
SonicParanoid 1 1.000 - - X3172
TreeFam 1 0.960 - -
1514.730

Return to query results.
Submit another query.