DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14757 and Sdhaf2

DIOPT Version :10

Sequence 1:NP_610363.1 Gene:CG14757 / 35797 FlyBaseID:FBgn0033274 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_079609.2 Gene:Sdhaf2 / 66072 MGIID:1913322 Length:164 Species:Mus musculus


Alignment Length:147 Identity:71/147 - (48%)
Similarity:95/147 - (64%) Gaps:8/147 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RSMSNMKDSPPPPPPLASTF-----NDVIVD-YEDPDYLPLPEYPVRPNEPLETRKQRLLYQSRK 79
            |::|  |.|...|.|..::|     .|...| .:|...:|||.:..|.:|.:||::.||||:|||
Mouse    12 RALS--KHSLLSPLPSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTDESIETKRARLLYESRK 74

  Fly    80 RGMLENDLLLSTFAAKHLQNFSAEQTAQYDQLINGVSNDWDIYYWATEVKPTPKEYDTEIMGLLK 144
            ||||||.:|||.||.::|.|.:.:|...||:|||..||||||||||||.||.|:.::.|:|.||:
Mouse    75 RGMLENCILLSLFAKEYLHNMTEKQLNLYDRLINEPSNDWDIYYWATEAKPAPEIFENEVMELLR 139

  Fly   145 EHVKNAERVTRLRQPDL 161
            |..||..:..|||.|||
Mouse   140 EFAKNKNKEQRLRAPDL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14757NP_610363.1 Sdh5 72..147 CDD:461097 46/74 (62%)
Sdhaf2NP_079609.2 Sdh5 66..142 CDD:461097 46/75 (61%)

Return to query results.
Submit another query.