DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14757 and SDHAF2

DIOPT Version :9

Sequence 1:NP_610363.1 Gene:CG14757 / 35797 FlyBaseID:FBgn0033274 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_060311.1 Gene:SDHAF2 / 54949 HGNCID:26034 Length:166 Species:Homo sapiens


Alignment Length:109 Identity:61/109 - (55%)
Similarity:81/109 - (74%) Gaps:0/109 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LPLPEYPVRPNEPLETRKQRLLYQSRKRGMLENDLLLSTFAAKHLQNFSAEQTAQYDQLINGVSN 117
            :|||.:..|.:|.:||::.||||:|||||||||.:|||.||.:|||:.:.:|...||:|||..||
Human    50 IPLPPWQERTDESIETKRARLLYESRKRGMLENCILLSLFAKEHLQHMTEKQLNLYDRLINEPSN 114

  Fly   118 DWDIYYWATEVKPTPKEYDTEIMGLLKEHVKNAERVTRLRQPDL 161
            ||||||||||.||.|:.::.|:|.||::..||..:..|||.|||
Human   115 DWDIYYWATEAKPAPEIFENEVMALLRDFAKNKNKEQRLRAPDL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14757NP_610363.1 Sdh5 70..143 CDD:281870 44/72 (61%)
SDHAF2NP_060311.1 Sdh5 67..140 CDD:397843 44/72 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142941
Domainoid 1 1.000 98 1.000 Domainoid score I7190
eggNOG 1 0.900 - - E1_COG2938
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32370
Inparanoid 1 1.050 133 1.000 Inparanoid score I4606
Isobase 1 0.950 - 0 Normalized mean entropy S1158
OMA 1 1.010 - - QHG48810
OrthoDB 1 1.010 - - D1492851at2759
OrthoFinder 1 1.000 - - FOG0003243
OrthoInspector 1 1.000 - - otm40823
orthoMCL 1 0.900 - - OOG6_102226
Panther 1 1.100 - - LDO PTHR12469
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1299
SonicParanoid 1 1.000 - - X3172
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.