DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14757 and Sdhaf2

DIOPT Version :9

Sequence 1:NP_610363.1 Gene:CG14757 / 35797 FlyBaseID:FBgn0033274 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_001008372.1 Gene:Sdhaf2 / 361726 RGDID:1309216 Length:164 Species:Rattus norvegicus


Alignment Length:109 Identity:61/109 - (55%)
Similarity:80/109 - (73%) Gaps:0/109 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LPLPEYPVRPNEPLETRKQRLLYQSRKRGMLENDLLLSTFAAKHLQNFSAEQTAQYDQLINGVSN 117
            :|||.:..|.:|.:||::.||||:|||||||||.:|||.||.::|.|.:.:|...||:|||..||
  Rat    48 IPLPPWQERTDESIETKRARLLYESRKRGMLENCILLSLFAKEYLHNMTEKQLNLYDRLINEPSN 112

  Fly   118 DWDIYYWATEVKPTPKEYDTEIMGLLKEHVKNAERVTRLRQPDL 161
            ||||||||||.||.|:.::.|:|.||:|..||..:..|||.|||
  Rat   113 DWDIYYWATEAKPAPEIFENEVMELLREFTKNKNKEQRLRAPDL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14757NP_610363.1 Sdh5 70..143 CDD:281870 43/72 (60%)
Sdhaf2NP_001008372.1 Sdh5 65..138 CDD:397843 43/72 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336641
Domainoid 1 1.000 96 1.000 Domainoid score I7140
eggNOG 1 0.900 - - E1_COG2938
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32370
Inparanoid 1 1.050 131 1.000 Inparanoid score I4534
OMA 1 1.010 - - QHG48810
OrthoDB 1 1.010 - - D1492851at2759
OrthoFinder 1 1.000 - - FOG0003243
OrthoInspector 1 1.000 - - otm44966
orthoMCL 1 0.900 - - OOG6_102226
Panther 1 1.100 - - LDO PTHR12469
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3172
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.