DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14757 and SPAC12B10.06c

DIOPT Version :9

Sequence 1:NP_610363.1 Gene:CG14757 / 35797 FlyBaseID:FBgn0033274 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_594638.1 Gene:SPAC12B10.06c / 2542705 PomBaseID:SPAC12B10.06c Length:139 Species:Schizosaccharomyces pombe


Alignment Length:105 Identity:40/105 - (38%)
Similarity:60/105 - (57%) Gaps:7/105 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RPNEPLETRK---QRLLYQSRKRGMLENDLLLSTFAAKHLQNFSAEQTAQYDQLINGVSNDWDIY 122
            |.|...|||.   .||.|||||||:||.|||||.||...:..:......:||||::  ..||||.
pombe    37 RVNRSYETRDAMLARLKYQSRKRGILETDLLLSNFAKDQIDKYPVSLLREYDQLLD--EPDWDIL 99

  Fly   123 YWATEVKPTPKEY-DTEIMGLLKEHVKNAERVTRLRQPDL 161
            ||.:..:..|::: .:::...|.::.: ::|...||.|:|
pombe   100 YWCSGEREAPEKWKSSQVFKELSKYCR-SQRNHTLRMPEL 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14757NP_610363.1 Sdh5 70..143 CDD:281870 29/76 (38%)
SPAC12B10.06cNP_594638.1 SdhE 35..130 CDD:225489 35/95 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 62 1.000 Domainoid score I2938
eggNOG 1 0.900 - - E1_COG2938
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1940
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003243
OrthoInspector 1 1.000 - - otm47131
orthoMCL 1 0.900 - - OOG6_102226
Panther 1 1.100 - - LDO PTHR12469
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1299
SonicParanoid 1 1.000 - - X3172
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.