DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14757 and Y57A10A.29

DIOPT Version :9

Sequence 1:NP_610363.1 Gene:CG14757 / 35797 FlyBaseID:FBgn0033274 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_496607.1 Gene:Y57A10A.29 / 174870 WormBaseID:WBGene00013269 Length:119 Species:Caenorhabditis elegans


Alignment Length:95 Identity:36/95 - (37%)
Similarity:64/95 - (67%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 PNEPLETRKQRLLYQSRKRGMLENDLLLSTFAAKHLQNFSAEQTAQYDQLINGVSNDWDIYYWAT 126
            |.|.::.::.||||||:|||:||||:||..||.::|:..|..:...||:||||...:||::|:.:
 Worm    25 PGEKIDAKRARLLYQSKKRGILENDILLGDFAEQNLKKMSEPELKAYDKLINGEHMEWDLFYYLS 89

  Fly   127 EVKPTPKEYDT-EIMGLLKEHVKNAERVTR 155
            ..|..|::.:: ::...:|:.|.: :||.:
 Worm    90 NKKSPPEDVESCQVYQKVKKFVDD-KRVPK 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14757NP_610363.1 Sdh5 70..143 CDD:281870 30/73 (41%)
Y57A10A.29NP_496607.1 Sdh5 33..106 CDD:281870 30/72 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157428
Domainoid 1 1.000 71 1.000 Domainoid score I6147
eggNOG 1 0.900 - - E1_COG2938
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I3843
Isobase 1 0.950 - 0 Normalized mean entropy S1158
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1492851at2759
OrthoFinder 1 1.000 - - FOG0003243
OrthoInspector 1 1.000 - - otm14379
orthoMCL 1 0.900 - - OOG6_102226
Panther 1 1.100 - - LDO PTHR12469
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1299
SonicParanoid 1 1.000 - - X3172
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.780

Return to query results.
Submit another query.