Sequence 1: | NP_610362.1 | Gene: | Gasz / 35795 | FlyBaseID: | FBgn0033273 | Length: | 461 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001319860.1 | Gene: | AT4G03460 / 827916 | AraportID: | AT4G03460 | Length: | 628 | Species: | Arabidopsis thaliana |
Alignment Length: | 205 | Identity: | 49/205 - (23%) |
---|---|---|---|
Similarity: | 77/205 - (37%) | Gaps: | 58/205 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 KLYDAVVAGD---LKTMQEEMRKLVLQVDQPVKGGLNLLMLACREGHYKIVEWLLERAGANVNRQ 104
Fly 105 LDSLMPLMMACNTTHKDPCLAERIVGLLLRHGAVINVSEKYGMTPFMFACQNGFAGVVRLL---I 166
Fly 167 KDAS----------FDAVDNQGCTAIFHAIEKNHVEVVKLLVEAGANAT-IANNKGYTPTQVAEC 220
Fly 221 HGYYDLLEIL 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gasz | NP_610362.1 | Ank_2 | 44..141 | CDD:289560 | 20/99 (20%) |
ANK repeat | 73..106 | CDD:293786 | 8/32 (25%) | ||
ANK | 74..198 | CDD:238125 | 28/136 (21%) | ||
ANK repeat | 110..143 | CDD:293786 | 4/32 (13%) | ||
Ank_2 | 111..208 | CDD:289560 | 22/110 (20%) | ||
ANK repeat | 145..175 | CDD:293786 | 11/42 (26%) | ||
ANK repeat | 177..208 | CDD:293786 | 6/31 (19%) | ||
SAM | 273..324 | CDD:197735 | |||
SAM_superfamily | 273..321 | CDD:188886 | |||
PHA03233 | <289..>366 | CDD:223016 | |||
AT4G03460 | NP_001319860.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X100 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |