DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasz and AT4G03460

DIOPT Version :9

Sequence 1:NP_610362.1 Gene:Gasz / 35795 FlyBaseID:FBgn0033273 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_001319860.1 Gene:AT4G03460 / 827916 AraportID:AT4G03460 Length:628 Species:Arabidopsis thaliana


Alignment Length:205 Identity:49/205 - (23%)
Similarity:77/205 - (37%) Gaps:58/205 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KLYDAVVAGD---LKTMQEEMRKLVLQVDQPVKGGLNLLMLACREGHYKIVEWLLERAGANVNRQ 104
            |...||.|||   |:.|:.::...:..|:.   .|..:|.||...||..:|.::|          
plant    49 KTIAAVRAGDETYLRDMKFDVNIALSSVND---HGNTMLHLAAAAGHTDLVCYIL---------- 100

  Fly   105 LDSLMPLMMACNTTHKDPCLAERIVGLLLRHGAVINVSEKYGMTPFMFACQNGFAGVVRLL---I 166
              :..|                   |||::       |...|......|...|...||..|   |
plant   101 --NAYP-------------------GLLMK-------SNSMGEVALHVAAGAGHLAVVEALVSFI 137

  Fly   167 KDAS----------FDAVDNQGCTAIFHAIEKNHVEVVKLLVEAGANAT-IANNKGYTPTQVAEC 220
            ||.|          :.|.|.....|:..::::.|::|...||.|..:.: :|||.|.:|..:|..
plant   138 KDISCNKPGVAKKIYFAKDRHQDNALHVSLKRKHLKVASCLVCAEQSLSFVANNDGVSPLYLAVE 202

  Fly   221 HGYYDLLEIL 230
            .|..||.:.:
plant   203 AGQADLAKTM 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaszNP_610362.1 Ank_2 44..141 CDD:289560 20/99 (20%)
ANK repeat 73..106 CDD:293786 8/32 (25%)
ANK 74..198 CDD:238125 28/136 (21%)
ANK repeat 110..143 CDD:293786 4/32 (13%)
Ank_2 111..208 CDD:289560 22/110 (20%)
ANK repeat 145..175 CDD:293786 11/42 (26%)
ANK repeat 177..208 CDD:293786 6/31 (19%)
SAM 273..324 CDD:197735
SAM_superfamily 273..321 CDD:188886
PHA03233 <289..>366 CDD:223016
AT4G03460NP_001319860.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X100
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.