DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasz and ITN1

DIOPT Version :9

Sequence 1:NP_610362.1 Gene:Gasz / 35795 FlyBaseID:FBgn0033273 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_187842.1 Gene:ITN1 / 820414 AraportID:AT3G12360 Length:590 Species:Arabidopsis thaliana


Alignment Length:250 Identity:64/250 - (25%)
Similarity:108/250 - (43%) Gaps:29/250 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EQKLYDAVVAGDLKTMQEEMRKLVLQ-VDQPVKGGLNLLMLACREGHYKIVEWLLERAGANVNRQ 104
            |..|:.|...|.|..::|.::....: :.:..:.|.:.|.:|..:||:.|||.||:. .|.:::.
plant   130 ETALFTAADKGHLDVVKELLKYSSRESIAKKNRSGYDPLHIAAIQGHHAIVEVLLDH-DATLSQT 193

  Fly   105 L--DSLMPLMMACNTTHKDPCLAERIVGLLLRHGAVINVSEKYGMTPFMFACQNGFAGVVR-LLI 166
            .  .:..||:.|....|     .|.:..||.:.|.::.:|..........|.:.|...|:: ||.
plant   194 FGPSNATPLVSAAMRGH-----TEVVNQLLSKAGNLLEISRSNNKNALHLAARQGHVEVIKALLS 253

  Fly   167 KDASF-DAVDNQGCTAIFHAIEKNHVEVVKLLVEAGANATIANNKG-YTPTQVAECHGYYDLLEI 229
            ||... ..:|.:|.||:..|::....||||||::|.....:..:|. .|...||......:::|:
plant   254 KDPQLARRIDKKGQTALHMAVKGQSSEVVKLLLDADPAIVMQPDKSCNTALHVATRKKRAEIVEL 318

  Fly   230 LPRPASTYLVPTHFLGYNTL-RDHIPRIFLKSDCP-----EYFQEL---NGILEA 275
            |.....|        ..||| |||...:.:....|     .|.:|.   :|.|.|
plant   319 LLSLPDT--------NANTLTRDHKTALDIAEGLPLSEESSYIKECLARSGALRA 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaszNP_610362.1 Ank_2 44..141 CDD:289560 24/99 (24%)
ANK repeat 73..106 CDD:293786 11/34 (32%)
ANK 74..198 CDD:238125 37/127 (29%)
ANK repeat 110..143 CDD:293786 8/32 (25%)
Ank_2 111..208 CDD:289560 27/98 (28%)
ANK repeat 145..175 CDD:293786 7/31 (23%)
ANK repeat 177..208 CDD:293786 11/30 (37%)
SAM 273..324 CDD:197735 1/2 (50%)
SAM_superfamily 273..321 CDD:188886 1/2 (50%)
PHA03233 <289..>366 CDD:223016
ITN1NP_187842.1 ANK repeat 73..126 CDD:293786
ANK repeat 129..161 CDD:293786 6/30 (20%)
Ank_2 133..>321 CDD:393464 50/193 (26%)
ANK repeat 163..195 CDD:293786 11/32 (34%)
ANK repeat 235..263 CDD:293786 7/27 (26%)
ANK repeat 265..297 CDD:293786 11/31 (35%)
PGG 413..519 CDD:372845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.