DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasz and ankrd67

DIOPT Version :9

Sequence 1:NP_610362.1 Gene:Gasz / 35795 FlyBaseID:FBgn0033273 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_001122202.1 Gene:ankrd67 / 566073 ZFINID:ZDB-GENE-050419-160 Length:422 Species:Danio rerio


Alignment Length:178 Identity:50/178 - (28%)
Similarity:86/178 - (48%) Gaps:13/178 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 EMRKLVLQVDQPVKG----GLNLLMLACREGHYKIVEWLLERAGANVNRQLDSLMPLMMACNTTH 119
            ::.:|:|.....|:|    |::.|.||...|:...|..||:| ||:.|.:..:....|..|    
Zfish   198 DVAELLLDNGADVEGGKGVGMSPLQLAVLVGNEAGVRLLLQR-GADANMRGPNGRTAMHLC---- 257

  Fly   120 KDPCLAE-RIVGLLLRHGAVINVSEKYGMTPFMFACQNGFAGVVRLLI-KDASFDAVDNQGCTAI 182
              .|..: :|:..||..||.::|.:....:|...|.::|...||.||| ..|..:..||...|.:
Zfish   258 --ACSGDKKILQQLLAGGARVDVRDGDVASPLHLAARSGSRAVVHLLILNGAGLEDRDNLKMTPL 320

  Fly   183 FHAIEKNHVEVVKLLVEAGANATIANNKGYTPTQVAECHGYYDLLEIL 230
            .::..::::|..|||:..||:.......|.||..:|...|:..:|::|
Zfish   321 HYSTLRDNIEAAKLLLHYGADVNAVERLGQTPLHLASERGHCKVLKVL 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaszNP_610362.1 Ank_2 44..141 CDD:289560 24/86 (28%)
ANK repeat 73..106 CDD:293786 13/36 (36%)
ANK 74..198 CDD:238125 36/125 (29%)
ANK repeat 110..143 CDD:293786 9/33 (27%)
Ank_2 111..208 CDD:289560 27/98 (28%)
ANK repeat 145..175 CDD:293786 9/30 (30%)
ANK repeat 177..208 CDD:293786 7/30 (23%)
SAM 273..324 CDD:197735
SAM_superfamily 273..321 CDD:188886
PHA03233 <289..>366 CDD:223016
ankrd67NP_001122202.1 Ank_4 55..104 CDD:290365
ANK repeat 55..81 CDD:293786
ANK 78..204 CDD:238125 1/5 (20%)
ANK repeat 83..115 CDD:293786
Ank_2 89..181 CDD:289560
ANK repeat 119..148 CDD:293786
ANK repeat 150..181 CDD:293786
Ank_2 155..246 CDD:289560 16/48 (33%)
ANK repeat 183..211 CDD:293786 2/12 (17%)
ANK repeat 216..246 CDD:293786 12/30 (40%)
ANK 217..245 CDD:197603 11/28 (39%)
ANK 244..369 CDD:238125 35/131 (27%)
ANK repeat 249..280 CDD:293786 9/36 (25%)
Ank_4 250..303 CDD:290365 15/58 (26%)
ANK repeat 285..313 CDD:293786 9/27 (33%)
Ank_2 287..378 CDD:289560 24/82 (29%)
ANK repeat 315..346 CDD:293786 7/30 (23%)
ANK 343..>404 CDD:238125 7/26 (27%)
ANK repeat 348..378 CDD:293786 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578738
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.