DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasz and Espn

DIOPT Version :9

Sequence 1:NP_610362.1 Gene:Gasz / 35795 FlyBaseID:FBgn0033273 Length:461 Species:Drosophila melanogaster
Sequence 2:XP_006539122.1 Gene:Espn / 56226 MGIID:1861630 Length:896 Species:Mus musculus


Alignment Length:415 Identity:96/415 - (23%)
Similarity:149/415 - (35%) Gaps:95/415 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YDAVVAGDLKTMQEEMRKLVLQVDQPVKGGLNLLMLACREGHYKIVEWLLERAGAN--------- 100
            :||...|.|..:|..:.:...:|.:....|..:|.||.|.||..:|:|||.:.|||         
Mouse    75 HDAAATGYLSCLQWLLTQGGCRVQEKDNSGATVLHLAARFGHPDVVKWLLYQGGANSAITTDTGA 139

  Fly   101 -------------------------VNRQLDS-LMPLMMACNTTHKDPCLAERIVGLLLRH-GAV 138
                                     ||.|.:: ..||.:||...|.:      :...|::. .|.
Mouse   140 LPIHYAAAKGDLPSLKLLVGHYPEGVNAQTNNGATPLYLACQEGHLE------VTKYLVQECSAD 198

  Fly   139 INVSEKYGMTPFMFACQNGFAGVVRLLIK--DASFDAVDNQGCTAIFHAIEKNHVEVVKLLVEAG 201
            .::..:.||||...|.|.|...|:..|:.  |.||...|:.|.||:..|..:.|.:|:..|:..|
Mouse   199 PHLRAQDGMTPLHAAAQMGHNPVLVWLVSFADVSFSEQDHDGATAMHFAASRGHTKVLSWLLLHG 263

  Fly   202 ANATIANNKGYTPTQVAECHGYYDLLEILPRPASTYLVPTHFLGYNTLRDHIPRIFLKSDCPEYF 266
            |..: .:..|.||...|..:|..:..:||         ..:..|.: :|||..  :..:|..|: 
Mouse   264 AEIS-QDLWGGTPLHDAAENGELECCQIL---------AVNGAGLD-VRDHDG--YTAADLAEF- 314

  Fly   267 QELNGILEAINIGNMVQYFAIARISLADFLVMD-EQSLREIGIEYPIFRHKILTGILDFHLHHWS 330
               ||..........||..::....|:....|| |....:.|:..|.....:.....|.      
Mouse   315 ---NGHTHCSRYLRTVQTLSLEHRVLSRDQSMDLEAKQLDSGMSSPNTTMSVQPMTFDL------ 370

  Fly   331 NSSIARVKKDEMNNFYEILLITASHLQHLVIIQASLRFILKNQEHNKMGQPSEMQVAAMKSNLQG 395
                    ....:.|......::||...            |.|..|: |.|     .|..::||.
Mouse   371 --------GSPTSTFSNYDSCSSSHSSS------------KGQRSNR-GIP-----GARAADLQS 409

  Fly   396 YRDVLNQITKTVK-YLGSFSPSQNP 419
            |.|:||......: .||..||...|
Mouse   410 YMDMLNPEKSLPRGKLGKPSPPPPP 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaszNP_610362.1 Ank_2 44..141 CDD:289560 30/131 (23%)
ANK repeat 73..106 CDD:293786 17/66 (26%)
ANK 74..198 CDD:238125 43/161 (27%)
ANK repeat 110..143 CDD:293786 7/33 (21%)
Ank_2 111..208 CDD:289560 28/99 (28%)
ANK repeat 145..175 CDD:293786 12/31 (39%)
ANK repeat 177..208 CDD:293786 9/30 (30%)
SAM 273..324 CDD:197735 8/51 (16%)
SAM_superfamily 273..321 CDD:188886 8/48 (17%)
PHA03233 <289..>366 CDD:223016 10/77 (13%)
EspnXP_006539122.1 Ank_4 8..56 CDD:372654
ANK repeat 39..67 CDD:293786
Ank_2 41..127 CDD:372319 17/51 (33%)
ANK repeat 69..101 CDD:293786 6/25 (24%)
ANK repeat 103..135 CDD:293786 14/31 (45%)
Ank_2 108..202 CDD:372319 23/99 (23%)
ANK repeat 137..169 CDD:293786 2/31 (6%)
ANK repeat 171..202 CDD:293786 7/36 (19%)
Ank_2 176..266 CDD:372319 28/95 (29%)
ANK repeat 205..237 CDD:293786 12/31 (39%)
ANK repeat 239..269 CDD:293786 9/30 (30%)
Ank_2 244..324 CDD:372319 21/96 (22%)
ANK repeat 271..302 CDD:293786 8/40 (20%)
PHA02682 <650..>757 CDD:177464
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X100
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.