| Sequence 1: | NP_610362.1 | Gene: | Gasz / 35795 | FlyBaseID: | FBgn0033273 | Length: | 461 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006239651.1 | Gene: | Mib2 / 474147 | RGDID: | 1359469 | Length: | 982 | Species: | Rattus norvegicus |
| Alignment Length: | 272 | Identity: | 62/272 - (22%) |
|---|---|---|---|
| Similarity: | 103/272 - (37%) | Gaps: | 78/272 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 18 SSYDGFYFSDKVKRSKPAPYVDPEQKLYDAVVAGDLKTMQ----------EEMRKLVLQVDQPVK 72
Fly 73 ----GGLNL------------LMLACR---EGHYKIVEWLLER--------AGANVNRQLDSLMP 110
Fly 111 ------LMMACN---TTHKDP-----CLAERIVG-------LLLRHGAVINVSEKYGMTPFMFAC 154
Fly 155 QNGFAGVVRLLIK-DASFDAVDNQGCTAIFHAIEKNHVEVVKLLVEAGANATIANNKGYTPTQVA 218
Fly 219 ECHGYYDLLEIL 230 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Gasz | NP_610362.1 | Ank_2 | 44..141 | CDD:289560 | 31/154 (20%) |
| ANK repeat | 73..106 | CDD:293786 | 10/55 (18%) | ||
| ANK | 74..198 | CDD:238125 | 40/168 (24%) | ||
| ANK repeat | 110..143 | CDD:293786 | 12/53 (23%) | ||
| Ank_2 | 111..208 | CDD:289560 | 32/112 (29%) | ||
| ANK repeat | 145..175 | CDD:293786 | 11/30 (37%) | ||
| ANK repeat | 177..208 | CDD:293786 | 9/30 (30%) | ||
| SAM | 273..324 | CDD:197735 | |||
| SAM_superfamily | 273..321 | CDD:188886 | |||
| PHA03233 | <289..>366 | CDD:223016 | |||
| Mib2 | XP_006239651.1 | MIB_HERC2 | 12..78 | CDD:399589 | |
| ZZ_Mind_bomb | 89..133 | CDD:239079 | |||
| MIB_HERC2 | 160..224 | CDD:399589 | |||
| SH3_15 | 257..322 | CDD:408152 | |||
| SH3_15 | 328..392 | CDD:408152 | 13/81 (16%) | ||
| PLN03192 | <453..517 | CDD:215625 | 18/64 (28%) | ||
| PHA03095 | 486..>737 | CDD:222980 | 28/90 (31%) | ||
| ANK repeat | 490..520 | CDD:293786 | 11/29 (38%) | ||
| ANK repeat | 522..553 | CDD:293786 | 9/30 (30%) | ||
| ANK repeat | 555..586 | CDD:293786 | 6/21 (29%) | ||
| ANK repeat | 588..622 | CDD:293786 | |||
| ANK repeat | 625..656 | CDD:293786 | |||
| ANK repeat | 658..690 | CDD:293786 | |||
| ANK repeat | 692..723 | CDD:293786 | |||
| RING1-HC_MIB2 | 858..894 | CDD:319640 | |||
| RING_Ubox | 937..982 | CDD:418438 | |||
| RING-HC finger (C3HC4-type) | 938..970 | CDD:319361 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X100 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||