DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasz and nfkb2

DIOPT Version :9

Sequence 1:NP_610362.1 Gene:Gasz / 35795 FlyBaseID:FBgn0033273 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_001005032.1 Gene:nfkb2 / 448550 XenbaseID:XB-GENE-970084 Length:946 Species:Xenopus tropicalis


Alignment Length:188 Identity:43/188 - (22%)
Similarity:80/188 - (42%) Gaps:22/188 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LYDAVVAGDLKTMQEEMRKLVLQVDQPVKGGLNLLMLACREGHYKIVEWLLERAGANVNRQLDSL 108
            |.|..:..|.:.:....|.|:...|:   .|...|.||...|...::|.|::...:..|:|:.::
 Frog   478 LLDYAITADPRMLLAVQRHLIATQDE---NGDTPLHLAVIHGQPSVIEQLVQVIISIPNQQILNM 539

  Fly   109 ------MPLMMACNTTHKDPCLAERIVGLLLRHGAVINVSEKYGMTPFMFACQNGFAGVVRLLIK 167
                  .||.:...|....      :|..||:.||...:.::||.:....|.|.....::.:|:|
 Frog   540 SNHLQQTPLHLGVITKQYS------VVAFLLKAGADPTILDRYGNSVLHLAVQAEDDKMLSVLLK 598

  Fly   168 DAS------FDAVDNQGCTAIFHAIEKNHVEVVKLLVEAGANATIANNK-GYTPTQVA 218
            ..|      .:..|..|...:..:::..:.:.::|||:||||......| |.:|..:|
 Frog   599 YPSVGQKDLLNMPDYHGLCPVHWSVKMKNEKCLELLVKAGANVNSPERKSGKSPLHIA 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaszNP_610362.1 Ank_2 44..141 CDD:289560 23/102 (23%)
ANK repeat 73..106 CDD:293786 9/32 (28%)
ANK 74..198 CDD:238125 27/135 (20%)
ANK repeat 110..143 CDD:293786 8/32 (25%)
Ank_2 111..208 CDD:289560 23/102 (23%)
ANK repeat 145..175 CDD:293786 7/35 (20%)
ANK repeat 177..208 CDD:293786 8/30 (27%)
SAM 273..324 CDD:197735
SAM_superfamily 273..321 CDD:188886
PHA03233 <289..>366 CDD:223016
nfkb2NP_001005032.1 RHD-n_NFkB2 44..227 CDD:143650
RHD_dimer 235..334 CDD:292797
Ank_4 476..525 CDD:290365 12/49 (24%)
ANK 501..635 CDD:238125 28/142 (20%)
ANK repeat 504..541 CDD:293786 9/36 (25%)
ANK repeat 543..574 CDD:293786 8/36 (22%)
Ank_2 548..642 CDD:289560 23/99 (23%)
ANK 572..703 CDD:238125 20/85 (24%)
ANK repeat 614..645 CDD:293786 8/30 (27%)
Ank_2 620..713 CDD:289560 11/37 (30%)
ANK repeat 648..680 CDD:293786 3/9 (33%)
ANK repeat 682..707 CDD:293786
Death_NFkB2_p100 828..903 CDD:176776
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X100
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.