DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasz and Iqank1

DIOPT Version :9

Sequence 1:NP_610362.1 Gene:Gasz / 35795 FlyBaseID:FBgn0033273 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_001357849.1 Gene:Iqank1 / 432964 MGIID:3588184 Length:572 Species:Mus musculus


Alignment Length:214 Identity:48/214 - (22%)
Similarity:81/214 - (37%) Gaps:52/214 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YVDPEQKL----YDAVV--------------AGDLKTMQEEMRKLVLQVDQPVKGGLNLLMLACR 83
            |:|..:||    |.|:|              ..:.:..:||:::....::...:|.|..:....:
Mouse    92 YLDEMEKLQKEAYLALVRQEQEAARRQREKEEAEERARREELQRRRRLLEAAFEGDLGEIRQVLK 156

  Fly    84 EGHYKIVEWLLERAGANVNRQLDSLMPLMMACNTTHKDPCLAERIVGLLLRHGAVINVSEKYGMT 148
            |     ||.|:.|.|..                  :.:...|.|    |.|..|.:...:.:|.|
Mouse   157 E-----VEQLMTREGVG------------------YDEDGKARR----LQRRVATVECEDSHGNT 194

  Fly   149 PFMFACQNGFAGVVRLLIKDASFDAVDNQ----GCTAIFHAIEKNHVEVVKLLVEAGANATIANN 209
            |...|...|....::||   |...|..|.    |.|.::.|....|:|.|:.|::.||:..:..:
Mouse   195 PLSEAAAGGQTMAIQLL---AELGANPNTKGAFGRTPLYRAAFGGHLEAVEELLKIGADPRMYAD 256

  Fly   210 KGYTPTQVAECHGYYDLLE 228
            .|.||.|||.......:|:
Mouse   257 DGSTPEQVASLAAVASVLQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaszNP_610362.1 Ank_2 44..141 CDD:289560 19/114 (17%)
ANK repeat 73..106 CDD:293786 8/32 (25%)
ANK 74..198 CDD:238125 28/127 (22%)
ANK repeat 110..143 CDD:293786 5/32 (16%)
Ank_2 111..208 CDD:289560 24/100 (24%)
ANK repeat 145..175 CDD:293786 9/29 (31%)
ANK repeat 177..208 CDD:293786 9/34 (26%)
SAM 273..324 CDD:197735
SAM_superfamily 273..321 CDD:188886
PHA03233 <289..>366 CDD:223016
Iqank1NP_001357849.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62
ANK repeat 191..222 CDD:293786 10/33 (30%)
ANK 1. /evidence=ECO:0000255 191..220 9/31 (29%)
ANKYR <192..314 CDD:223738 26/87 (30%)
Ank_4 192..245 CDD:372654 16/55 (29%)
ANK repeat 224..255 CDD:293786 9/30 (30%)
ANK 2. /evidence=ECO:0000255 224..253 9/28 (32%)
Borrelia_P83 <287..>400 CDD:114011
AAA_9 427..>479 CDD:372311
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.