DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasz and tanc2b

DIOPT Version :9

Sequence 1:NP_610362.1 Gene:Gasz / 35795 FlyBaseID:FBgn0033273 Length:461 Species:Drosophila melanogaster
Sequence 2:XP_017213985.1 Gene:tanc2b / 335127 ZFINID:ZDB-GENE-030131-7067 Length:2164 Species:Danio rerio


Alignment Length:158 Identity:53/158 - (33%)
Similarity:78/158 - (49%) Gaps:7/158 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 GLNLLMLACREGHYKIVEWLLERAGANVNRQLDSLMPLMMACNTTHKDPCLAERIVGLLLRHGAV 138
            |...|..|...|..::...|||:..|........::||..:....|      .:||.||:.|||.
Zfish  1157 GETALSAAAGRGKLEVCRLLLEQGSAVAQPNRRGVLPLFSSVRQGH------WQIVDLLVSHGAD 1215

  Fly   139 INVSEKYGMTPFMFACQNGFAGVVR-LLIKDASFDAVDNQGCTAIFHAIEKNHVEVVKLLVEAGA 202
            :|:::|.|.||.|.|...|....|. |:.:.||.|.:|.:|.||:..|..|.|:.||:.|||.||
Zfish  1216 VNLADKQGRTPLMMAASEGHLDTVEFLMAQGASMDLMDKEGLTALSWACLKGHLSVVRCLVERGA 1280

  Fly   203 NATIANNKGYTPTQVAECHGYYDLLEIL 230
            ....|:..|.||..:|..:|..|:::.|
Zfish  1281 ATDHADKNGRTPLDLAAFYGDSDVVQFL 1308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaszNP_610362.1 Ank_2 44..141 CDD:289560 18/66 (27%)
ANK repeat 73..106 CDD:293786 8/31 (26%)
ANK 74..198 CDD:238125 40/124 (32%)
ANK repeat 110..143 CDD:293786 11/32 (34%)
Ank_2 111..208 CDD:289560 36/97 (37%)
ANK repeat 145..175 CDD:293786 11/30 (37%)
ANK repeat 177..208 CDD:293786 13/30 (43%)
SAM 273..324 CDD:197735
SAM_superfamily 273..321 CDD:188886
PHA03233 <289..>366 CDD:223016
tanc2bXP_017213985.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.