| Sequence 1: | NP_610362.1 | Gene: | Gasz / 35795 | FlyBaseID: | FBgn0033273 | Length: | 461 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038942075.1 | Gene: | Tanc2 / 303599 | RGDID: | 1309285 | Length: | 2077 | Species: | Rattus norvegicus |
| Alignment Length: | 294 | Identity: | 85/294 - (28%) |
|---|---|---|---|
| Similarity: | 122/294 - (41%) | Gaps: | 72/294 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MMSNLCKYGPPPDSDSDSSYD--GF-----YFSDKVKRSKPAPYVDPEQK-----LYDAVVAGDL 53
Fly 54 KTMQEEMRKLVLQVDQPVKG---GL--------NLLMLACREGHYKIVEWLL----------ERA 97
Fly 98 GANVNRQLDSL---MPLMMACNTTHKDPC--LAE-------------------------RIVGLL 132
Fly 133 LRHGAVINVSEKYGMTPFMFACQNGFAGVVR-LLIKDASFDAVDNQGCTAIFHAIEKNHVEVVKL 196
Fly 197 LVEAGANATIANNKGYTPTQVAECHGYYDLLEIL 230 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Gasz | NP_610362.1 | Ank_2 | 44..141 | CDD:289560 | 38/147 (26%) |
| ANK repeat | 73..106 | CDD:293786 | 13/53 (25%) | ||
| ANK | 74..198 | CDD:238125 | 52/172 (30%) | ||
| ANK repeat | 110..143 | CDD:293786 | 15/59 (25%) | ||
| Ank_2 | 111..208 | CDD:289560 | 41/124 (33%) | ||
| ANK repeat | 145..175 | CDD:293786 | 12/30 (40%) | ||
| ANK repeat | 177..208 | CDD:293786 | 12/30 (40%) | ||
| SAM | 273..324 | CDD:197735 | |||
| SAM_superfamily | 273..321 | CDD:188886 | |||
| PHA03233 | <289..>366 | CDD:223016 | |||
| Tanc2 | XP_038942075.1 | PHA03095 | 930..>1224 | CDD:222980 | 73/257 (28%) |
| ANK repeat | 963..989 | CDD:293786 | 4/14 (29%) | ||
| ANK repeat | 991..1022 | CDD:293786 | 7/30 (23%) | ||
| ANK repeat | 1108..1138 | CDD:293786 | 6/29 (21%) | ||
| ANK repeat | 1140..1171 | CDD:293786 | 9/30 (30%) | ||
| ANKYR | <1170..1296 | CDD:223738 | 33/90 (37%) | ||
| ANK repeat | 1174..1204 | CDD:293786 | 12/29 (41%) | ||
| ANK repeat | 1206..1237 | CDD:293786 | 12/30 (40%) | ||
| ANK repeat | 1239..1270 | CDD:293786 | 6/21 (29%) | ||
| ANK repeat | 1272..1302 | CDD:293786 | |||
| TPR | <1324..1442 | CDD:223533 | |||
| TPR repeat | 1331..1356 | CDD:276809 | |||
| TPR repeat | 1361..1404 | CDD:276809 | |||
| TPR repeat | 1409..1438 | CDD:276809 | |||
| PHA03247 | <1513..1708 | CDD:223021 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||