DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasz and Ankrd17

DIOPT Version :9

Sequence 1:NP_610362.1 Gene:Gasz / 35795 FlyBaseID:FBgn0033273 Length:461 Species:Drosophila melanogaster
Sequence 2:XP_006250825.1 Gene:Ankrd17 / 289521 RGDID:1562348 Length:2640 Species:Rattus norvegicus


Alignment Length:196 Identity:61/196 - (31%)
Similarity:98/196 - (50%) Gaps:18/196 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QKLYDAVVAGDLKTMQEEMRKLVLQ---VDQPVKGGLNLLMLACREGHYKIVEWLLERAGANVNR 103
            :.|.:|...||:..    :|||:::   |::..:.|.:||.|||..|:|::.:.|| ...|||..
  Rat   239 RSLAEACSEGDVNA----VRKLLIEGRSVNEHTEEGESLLCLACSAGYYELAQVLL-AMHANVED 298

  Fly   104 Q--LDSLMPLMMACNTTHKDPCLAERIVGLLLRHGAVINVSEKYGMTPFMFACQNGFAGVVRLLI 166
            :  ...:.|||.|.|..|      .:||.|||.|.|.:|.....|.|...:||..|:..||::|:
  Rat   299 RGIKGDITPLMAAANGGH------VKIVKLLLAHKADVNAQSSTGNTALTYACAGGYVDVVKVLL 357

  Fly   167 KD-ASFDAVDNQGCTAIFHAIEKNHVEVVKLLVEAGANATIANNKGYTPTQVAECH-GYYDLLEI 229
            :. ||.:..:..|.|.:..|....||||.:||:|.||.....:|:.........|: |:.:::..
  Rat   358 ESGASIEDHNENGHTPLMEAGSAGHVEVARLLLENGAGINTHSNEFKESALTLACYKGHLEMVRF 422

  Fly   230 L 230
            |
  Rat   423 L 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaszNP_610362.1 Ank_2 44..141 CDD:289560 34/101 (34%)
ANK repeat 73..106 CDD:293786 13/34 (38%)
ANK 74..198 CDD:238125 45/126 (36%)
ANK repeat 110..143 CDD:293786 14/32 (44%)
Ank_2 111..208 CDD:289560 35/97 (36%)
ANK repeat 145..175 CDD:293786 10/30 (33%)
ANK repeat 177..208 CDD:293786 12/30 (40%)
SAM 273..324 CDD:197735
SAM_superfamily 273..321 CDD:188886
PHA03233 <289..>366 CDD:223016
Ankrd17XP_006250825.1 Ank_2 241..333 CDD:289560 35/102 (34%)
ANK repeat 241..267 CDD:293786 8/29 (28%)
ANK 264..390 CDD:238125 45/132 (34%)
ANK repeat 269..301 CDD:293786 13/32 (41%)
ANK repeat 306..334 CDD:293786 14/33 (42%)
Ank_2 308..397 CDD:289560 35/94 (37%)
ANK 331..457 CDD:238125 27/93 (29%)
ANK repeat 336..367 CDD:293786 10/30 (33%)
ANK repeat 369..397 CDD:293786 12/27 (44%)
ANK 399..523 CDD:238125 4/25 (16%)
ANK repeat 403..434 CDD:293786 3/21 (14%)
Ank_4 406..457 CDD:290365 3/18 (17%)
ANK repeat 438..467 CDD:293786
Ank_2 441..532 CDD:289560
ANK repeat 469..500 CDD:293786
ANK repeat 502..532 CDD:293786
ANK repeat 535..564 CDD:293786
Ank_4 539..587 CDD:290365
ANK 569..687 CDD:238125
ANK repeat 569..597 CDD:293786
Ank_2 571..662 CDD:289560
ANK repeat 599..630 CDD:293786
ANK repeat 632..661 CDD:293786
Ank_2 637..726 CDD:289560
ANK 665..>739 CDD:238125
ANK repeat 666..696 CDD:293786
OmpH 797..>896 CDD:281871
AhaH 808..884 CDD:131972
ANKYR 1074..1300 CDD:223738
ANK 1110..1138 CDD:197603
ANK repeat 1112..1141 CDD:293786
ANK 1139..1266 CDD:238125
ANK repeat 1143..1175 CDD:293786
ANK repeat 1177..1208 CDD:293786
ANK repeat 1210..1241 CDD:293786
ANK repeat 1245..1275 CDD:293786
ANK repeat 1278..1310 CDD:293786
ANK 1308..1434 CDD:238125
ANK repeat 1312..1341 CDD:293786
Ank_2 1317..1411 CDD:289560
ANK repeat 1349..1378 CDD:293786
ANK repeat 1380..1411 CDD:293786
NusA <1748..1795 CDD:223273
KH-I 1755..1817 CDD:238053
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.