Sequence 1: | NP_610362.1 | Gene: | Gasz / 35795 | FlyBaseID: | FBgn0033273 | Length: | 461 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006250825.1 | Gene: | Ankrd17 / 289521 | RGDID: | 1562348 | Length: | 2640 | Species: | Rattus norvegicus |
Alignment Length: | 196 | Identity: | 61/196 - (31%) |
---|---|---|---|
Similarity: | 98/196 - (50%) | Gaps: | 18/196 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 QKLYDAVVAGDLKTMQEEMRKLVLQ---VDQPVKGGLNLLMLACREGHYKIVEWLLERAGANVNR 103
Fly 104 Q--LDSLMPLMMACNTTHKDPCLAERIVGLLLRHGAVINVSEKYGMTPFMFACQNGFAGVVRLLI 166
Fly 167 KD-ASFDAVDNQGCTAIFHAIEKNHVEVVKLLVEAGANATIANNKGYTPTQVAECH-GYYDLLEI 229
Fly 230 L 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gasz | NP_610362.1 | Ank_2 | 44..141 | CDD:289560 | 34/101 (34%) |
ANK repeat | 73..106 | CDD:293786 | 13/34 (38%) | ||
ANK | 74..198 | CDD:238125 | 45/126 (36%) | ||
ANK repeat | 110..143 | CDD:293786 | 14/32 (44%) | ||
Ank_2 | 111..208 | CDD:289560 | 35/97 (36%) | ||
ANK repeat | 145..175 | CDD:293786 | 10/30 (33%) | ||
ANK repeat | 177..208 | CDD:293786 | 12/30 (40%) | ||
SAM | 273..324 | CDD:197735 | |||
SAM_superfamily | 273..321 | CDD:188886 | |||
PHA03233 | <289..>366 | CDD:223016 | |||
Ankrd17 | XP_006250825.1 | Ank_2 | 241..333 | CDD:289560 | 35/102 (34%) |
ANK repeat | 241..267 | CDD:293786 | 8/29 (28%) | ||
ANK | 264..390 | CDD:238125 | 45/132 (34%) | ||
ANK repeat | 269..301 | CDD:293786 | 13/32 (41%) | ||
ANK repeat | 306..334 | CDD:293786 | 14/33 (42%) | ||
Ank_2 | 308..397 | CDD:289560 | 35/94 (37%) | ||
ANK | 331..457 | CDD:238125 | 27/93 (29%) | ||
ANK repeat | 336..367 | CDD:293786 | 10/30 (33%) | ||
ANK repeat | 369..397 | CDD:293786 | 12/27 (44%) | ||
ANK | 399..523 | CDD:238125 | 4/25 (16%) | ||
ANK repeat | 403..434 | CDD:293786 | 3/21 (14%) | ||
Ank_4 | 406..457 | CDD:290365 | 3/18 (17%) | ||
ANK repeat | 438..467 | CDD:293786 | |||
Ank_2 | 441..532 | CDD:289560 | |||
ANK repeat | 469..500 | CDD:293786 | |||
ANK repeat | 502..532 | CDD:293786 | |||
ANK repeat | 535..564 | CDD:293786 | |||
Ank_4 | 539..587 | CDD:290365 | |||
ANK | 569..687 | CDD:238125 | |||
ANK repeat | 569..597 | CDD:293786 | |||
Ank_2 | 571..662 | CDD:289560 | |||
ANK repeat | 599..630 | CDD:293786 | |||
ANK repeat | 632..661 | CDD:293786 | |||
Ank_2 | 637..726 | CDD:289560 | |||
ANK | 665..>739 | CDD:238125 | |||
ANK repeat | 666..696 | CDD:293786 | |||
OmpH | 797..>896 | CDD:281871 | |||
AhaH | 808..884 | CDD:131972 | |||
ANKYR | 1074..1300 | CDD:223738 | |||
ANK | 1110..1138 | CDD:197603 | |||
ANK repeat | 1112..1141 | CDD:293786 | |||
ANK | 1139..1266 | CDD:238125 | |||
ANK repeat | 1143..1175 | CDD:293786 | |||
ANK repeat | 1177..1208 | CDD:293786 | |||
ANK repeat | 1210..1241 | CDD:293786 | |||
ANK repeat | 1245..1275 | CDD:293786 | |||
ANK repeat | 1278..1310 | CDD:293786 | |||
ANK | 1308..1434 | CDD:238125 | |||
ANK repeat | 1312..1341 | CDD:293786 | |||
Ank_2 | 1317..1411 | CDD:289560 | |||
ANK repeat | 1349..1378 | CDD:293786 | |||
ANK repeat | 1380..1411 | CDD:293786 | |||
NusA | <1748..1795 | CDD:223273 | |||
KH-I | 1755..1817 | CDD:238053 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |