| Sequence 1: | NP_610362.1 | Gene: | Gasz / 35795 | FlyBaseID: | FBgn0033273 | Length: | 461 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011522899.1 | Gene: | TANC2 / 26115 | HGNCID: | 30212 | Length: | 2075 | Species: | Homo sapiens |
| Alignment Length: | 300 | Identity: | 83/300 - (27%) |
|---|---|---|---|
| Similarity: | 120/300 - (40%) | Gaps: | 84/300 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MMSNLCKYGPPPDSDSDSSYD--GF-----YFSDKVKRSKPAPYVDPEQK-----LYDAVVAGDL 53
Fly 54 KTMQEEMRKLVLQVDQPVKG---GL--------NLLMLACREGHYKIVEWLL----------ERA 97
Fly 98 GANVNRQLDSL------------------------------------MPLMMACNTTHKDPCLAE 126
Fly 127 RIVGLLLRHGAVINVSEKYGMTPFMFACQNGFAGVVR-LLIKDASFDAVDNQGCTAIFHAIEKNH 190
Fly 191 VEVVKLLVEAGANATIANNKGYTPTQVAECHGYYDLLEIL 230 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Gasz | NP_610362.1 | Ank_2 | 44..141 | CDD:289560 | 35/153 (23%) |
| ANK repeat | 73..106 | CDD:293786 | 13/53 (25%) | ||
| ANK | 74..198 | CDD:238125 | 49/178 (28%) | ||
| ANK repeat | 110..143 | CDD:293786 | 12/32 (38%) | ||
| Ank_2 | 111..208 | CDD:289560 | 37/97 (38%) | ||
| ANK repeat | 145..175 | CDD:293786 | 12/30 (40%) | ||
| ANK repeat | 177..208 | CDD:293786 | 12/30 (40%) | ||
| SAM | 273..324 | CDD:197735 | |||
| SAM_superfamily | 273..321 | CDD:188886 | |||
| PHA03233 | <289..>366 | CDD:223016 | |||
| TANC2 | XP_011522899.1 | AAA_16 | 415..>457 | CDD:289934 | |
| Ank_4 | 962..1011 | CDD:290365 | 10/36 (28%) | ||
| ANK repeat | 963..989 | CDD:293786 | 4/14 (29%) | ||
| ANK | 986..1194 | CDD:238125 | 56/221 (25%) | ||
| ANK repeat | 991..1022 | CDD:293786 | 8/30 (27%) | ||
| Ank_2 | 996..1132 | CDD:289560 | 32/143 (22%) | ||
| ANK repeat | 1108..1138 | CDD:293786 | 0/29 (0%) | ||
| Ank_2 | 1112..1204 | CDD:289560 | 25/97 (26%) | ||
| ANK repeat | 1140..1171 | CDD:293786 | 12/36 (33%) | ||
| ANK | 1168..1293 | CDD:238125 | 33/91 (36%) | ||
| ANK repeat | 1174..1204 | CDD:293786 | 12/29 (41%) | ||
| Ank_2 | 1178..1270 | CDD:289560 | 28/81 (35%) | ||
| ANK repeat | 1206..1237 | CDD:293786 | 12/30 (40%) | ||
| ANK repeat | 1239..1270 | CDD:293786 | 5/20 (25%) | ||
| ANK repeat | 1272..1302 | CDD:293786 | |||
| TPR_11 | 1331..1406 | CDD:290150 | |||
| TPR repeat | 1331..1356 | CDD:276809 | |||
| TPR repeat | 1361..1404 | CDD:276809 | |||
| TPR_11 | 1377..1441 | CDD:290150 | |||
| TPR repeat | 1409..1438 | CDD:276809 | |||
| TFIIA | 1487..>1714 | CDD:281188 | |||
| ANAPC1 | <1512..1583 | CDD:289618 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||