DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasz and ZK1320.7

DIOPT Version :9

Sequence 1:NP_610362.1 Gene:Gasz / 35795 FlyBaseID:FBgn0033273 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_496087.2 Gene:ZK1320.7 / 259457 WormBaseID:WBGene00014256 Length:371 Species:Caenorhabditis elegans


Alignment Length:84 Identity:26/84 - (30%)
Similarity:41/84 - (48%) Gaps:4/84 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 NVSEKYGMTPFMFACQNG-FAGVVRLLIKDASFDAVDNQGCTAIFHAIEKNHVEVVKLLVEAGAN 203
            ||.:..|   |:.|.::| ...:.|.|.|....|..|..|.||...|..:.:.||.|||:|.||:
 Worm   112 NVRDVNG---FLKAAKDGNLEEIKRYLEKKIPIDVTDFYGWTATMCAAGEGNFEVCKLLLEHGAD 173

  Fly   204 ATIANNKGYTPTQVAECHG 222
            ..:.::......|:|:.:|
 Worm   174 PGVRDSHSLGIVQIAQKNG 192

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity