DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasz and MIB2

DIOPT Version :9

Sequence 1:NP_610362.1 Gene:Gasz / 35795 FlyBaseID:FBgn0033273 Length:461 Species:Drosophila melanogaster
Sequence 2:XP_016855838.1 Gene:MIB2 / 142678 HGNCID:30577 Length:1297 Species:Homo sapiens


Alignment Length:274 Identity:65/274 - (23%)
Similarity:111/274 - (40%) Gaps:52/274 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SNLCKYGPPPDSDSDSSYDGFYFSDKVKRSKPAPYV----------DPEQ--KLYDAVVAGDLKT 55
            |.|..|.|..|::.|       .:::.:.:|.:..|          |||.  :|...|..|:...
Human   675 SCLVAYRPEEDANLD-------VAERARENKSSLSVALDKLRAQKSDPEHPGRLVVEVALGNAAR 732

  Fly    56 MQEEMRKLVLQVDQPVKGGLNLLMLACREGHYKIVEWLLE-RAG--------------ANVNRQL 105
            ..:.:|:...|||.. ..|...|.:|...|..:::..||: |||              |.:..|.
Human   733 ALDLLRRRPEQVDTK-NQGRTALQVAAYLGQVELIRLLLQARAGVDLPDDEGNTALHYAALGNQP 796

  Fly   106 DSLMPLMMA-C-----NTTHKDP--CLAER----IVGLLLRHGAVINVSEKYGMTPFMFACQ--N 156
            ::...|:.| |     |:|....  ...:|    :|..|...|..:|:.:.:..||...|..  .
Human   797 EATRVLLSAGCRADAINSTQSTALHVAVQRGFLEVVRALCERGCDVNLPDAHSDTPLHSAISAGT 861

  Fly   157 GFAGVVRLLIKDASFD--AVDNQGCTAIFHAIEKNH-VEVVKLLVEAGANATIANNKGYTPTQVA 218
            |.:|:|.:|.:..:.|  |.::||.|.:.||..|.| :.|.|:|..|..........|:|...:|
Human   862 GASGIVEVLTEVPNIDVTATNSQGFTLLHHASLKGHALAVRKILARARQLVDAKKEDGFTALHLA 926

  Fly   219 ECHGYYDLLEILPR 232
            ..:.:.::.:||.|
Human   927 ALNNHREVAQILIR 940

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaszNP_610362.1 Ank_2 44..141 CDD:289560 27/123 (22%)
ANK repeat 73..106 CDD:293786 11/47 (23%)
ANK 74..198 CDD:238125 39/155 (25%)
ANK repeat 110..143 CDD:293786 10/44 (23%)
Ank_2 111..208 CDD:289560 30/113 (27%)
ANK repeat 145..175 CDD:293786 9/33 (27%)
ANK repeat 177..208 CDD:293786 11/31 (35%)
SAM 273..324 CDD:197735
SAM_superfamily 273..321 CDD:188886
PHA03233 <289..>366 CDD:223016
MIB2XP_016855838.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X100
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.