DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasz and AgaP_AGAP011932

DIOPT Version :9

Sequence 1:NP_610362.1 Gene:Gasz / 35795 FlyBaseID:FBgn0033273 Length:461 Species:Drosophila melanogaster
Sequence 2:XP_320601.4 Gene:AgaP_AGAP011932 / 1280737 VectorBaseID:AGAP011932 Length:1186 Species:Anopheles gambiae


Alignment Length:434 Identity:88/434 - (20%)
Similarity:148/434 - (34%) Gaps:162/434 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KRSKPAPYVDPEQKLYDAVVAGDLKTMQEEM-------------------------RKLVLQVD- 68
            |..:|....|..::|..|...||...::|.:                         .:.|::|| 
Mosquito   442 KLFEPHASGDTTEELVKAAANGDKAKVEEFLIGSAGGQNVAPSSSSAAGAAASLGESQSVVKVDV 506

  Fly    69 QPVKGGLNLLMLACREGHYKIVEWLLERAGANVNRQLDSLMPLMMACNTTHKDPCLAER------ 127
            ..|..|...|..|.:.||.:::|.|| |..|:|..:              .||...|..      
Mosquito   507 NGVFAGHTALQAASQNGHLEVIEVLL-RHNADVEIE--------------DKDGDRAVHHAAFGD 556

  Fly   128 ---IVGLLLRHGAVINVSEKYGMTPFMFACQNGFAGVVRLLIK-DASFDAVDNQGCTAIFHAIEK 188
               ::|:|.:.||.:|...|...|....|...|...||:.|:: :......|::|.||:..||.|
Mosquito   557 EPGVMGMLAKAGADLNARNKRRQTALHIAVNKGHFNVVKTLLELNCHPSLQDSEGDTALHDAISK 621

  Fly   189 NHVEVVKLLVEAGANATIANNKGYTPTQVAECHGYYDLLEILPRPASTYLVPTHFL--------- 244
            .|..::.||::.||:.|:.||.|:.....|...|....:::|       |..|:.|         
Mosquito   622 EHDNMLALLLDNGADITLTNNNGFNALHHAALKGNPSAMKVL-------LTKTNRLWIVEEKKDD 679

  Fly   245 GYNTLRDHIPRIFLKSDCPEYFQELNGILEAINIGNMVQYFAIARISLADFLVMDEQSLREIGIE 309
            ||..|.                      |.|:|          ..:.:|:.||            
Mosquito   680 GYTALH----------------------LAALN----------NHVEIAELLV------------ 700

  Fly   310 YPIFRHKILTGILDFHLHHWSNSSIARVKKDEMNNFYEILLITASHL----QHLVIIQ------A 364
                                      |:.|..| :...:.|.||.||    ||:.|::      |
Mosquito   701 --------------------------RMGKANM-DCQNVNLQTALHLAVERQHVQIVKLLVREGA 738

  Fly   365 SLRFILKNQE--------HNKMGQPSEMQVAAMKSNLQGYRDVL 400
            :|....|:.:        |:.:.|..::|      :::|:..:|
Mosquito   739 NLNIPDKDGDTPLHEALRHHTLSQLRQLQ------DVEGFGKIL 776

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaszNP_610362.1 Ank_2 44..141 CDD:289560 27/131 (21%)
ANK repeat 73..106 CDD:293786 11/32 (34%)
ANK 74..198 CDD:238125 35/133 (26%)
ANK repeat 110..143 CDD:293786 8/41 (20%)
Ank_2 111..208 CDD:289560 28/106 (26%)
ANK repeat 145..175 CDD:293786 6/30 (20%)
ANK repeat 177..208 CDD:293786 12/30 (40%)
SAM 273..324 CDD:197735 6/50 (12%)
SAM_superfamily 273..321 CDD:188886 6/47 (13%)
PHA03233 <289..>366 CDD:223016 15/86 (17%)
AgaP_AGAP011932XP_320601.4 MIB_HERC2 38..94 CDD:284184
ZZ_Mind_bomb 106..150 CDD:239079
MIB_HERC2 177..241 CDD:284184
ANK repeat 512..575 CDD:293786 19/77 (25%)
Ank_4 512..564 CDD:290365 15/66 (23%)
Ank 512..543 CDD:278452 11/45 (24%)
Ank_2 550..641 CDD:289560 25/90 (28%)
ANK 572..700 CDD:238125 37/166 (22%)
ANK repeat 577..608 CDD:293786 6/30 (20%)
ANK repeat 610..641 CDD:293786 12/30 (40%)
ANK repeat 643..677 CDD:293786 7/40 (18%)
Ank_2 648..744 CDD:289560 28/173 (16%)
ANK 678..826 CDD:238125 28/176 (16%)
ANK repeat 679..711 CDD:293786 12/102 (12%)
ANK repeat 713..744 CDD:293786 10/30 (33%)
Ank_2 718..806 CDD:289560 13/65 (20%)
ANK repeat 746..806 CDD:293786 5/37 (14%)
zf-C3HC4_3 925..968 CDD:290631
zf-C3HC4_3 970..1015 CDD:290631
zf-C3HC4_3 1139..1182 CDD:290631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X100
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.