| Sequence 1: | NP_610362.1 | Gene: | Gasz / 35795 | FlyBaseID: | FBgn0033273 | Length: | 461 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_320386.4 | Gene: | AgaP_AGAP012141 / 1280536 | VectorBaseID: | AGAP012141 | Length: | 1424 | Species: | Anopheles gambiae |
| Alignment Length: | 233 | Identity: | 66/233 - (28%) |
|---|---|---|---|
| Similarity: | 102/233 - (43%) | Gaps: | 52/233 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 38 VDPEQKLYDAVVAGDLKTMQEEMRKLVL----QVDQPVKGGLNLLMLACREGHYKIVEWLLERAG 98
Fly 99 ANVNRQLD-SLMPLMMACNTTHKDPCLAERIVGLLLR-HGAVINVSEKYGMTPFMFACQNGFAGV 161
Fly 162 VRLLIK-DASFD---------------------------------AVDNQGCTAIFHAIEKNHVE 192
Fly 193 VVKLLVEAGANATIANNKGYTPTQVAECHGYYDLLEIL 230 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Gasz | NP_610362.1 | Ank_2 | 44..141 | CDD:289560 | 30/102 (29%) |
| ANK repeat | 73..106 | CDD:293786 | 13/32 (41%) | ||
| ANK | 74..198 | CDD:238125 | 46/159 (29%) | ||
| ANK repeat | 110..143 | CDD:293786 | 12/33 (36%) | ||
| Ank_2 | 111..208 | CDD:289560 | 36/131 (27%) | ||
| ANK repeat | 145..175 | CDD:293786 | 14/63 (22%) | ||
| ANK repeat | 177..208 | CDD:293786 | 9/30 (30%) | ||
| SAM | 273..324 | CDD:197735 | |||
| SAM_superfamily | 273..321 | CDD:188886 | |||
| PHA03233 | <289..>366 | CDD:223016 | |||
| AgaP_AGAP012141 | XP_320386.4 | ANK | 103..228 | CDD:238125 | 28/99 (28%) |
| ANK repeat | 108..139 | CDD:293786 | |||
| Ank_2 | 113..203 | CDD:289560 | 20/68 (29%) | ||
| ANK repeat | 141..172 | CDD:293786 | 7/35 (20%) | ||
| ANK repeat | 174..203 | CDD:293786 | 13/29 (45%) | ||
| Ank_4 | 208..262 | CDD:290365 | 23/59 (39%) | ||
| ANK | 236..361 | CDD:238125 | 35/125 (28%) | ||
| ANK repeat | 241..272 | CDD:293786 | 13/30 (43%) | ||
| Ank_2 | 246..338 | CDD:289560 | 20/91 (22%) | ||
| ANK repeat | 274..305 | CDD:293786 | 1/30 (3%) | ||
| ANK | 302..427 | CDD:238125 | 19/59 (32%) | ||
| ANK repeat | 307..338 | CDD:293786 | 9/30 (30%) | ||
| ANK repeat | 340..370 | CDD:293786 | 8/21 (38%) | ||
| Ank_2 | 345..437 | CDD:289560 | 5/16 (31%) | ||
| ANK | 368..490 | CDD:238125 | |||
| ANK repeat | 373..404 | CDD:293786 | |||
| ANK repeat | 406..437 | CDD:293786 | |||
| Ank_5 | 426..480 | CDD:290568 | |||
| KAP_NTPase | 512..1043 | CDD:284995 | |||
| TMEM18 | 555..>612 | CDD:291436 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||