DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasz and AgaP_AGAP008851

DIOPT Version :9

Sequence 1:NP_610362.1 Gene:Gasz / 35795 FlyBaseID:FBgn0033273 Length:461 Species:Drosophila melanogaster
Sequence 2:XP_319593.4 Gene:AgaP_AGAP008851 / 1279818 VectorBaseID:AGAP008851 Length:1034 Species:Anopheles gambiae


Alignment Length:414 Identity:90/414 - (21%)
Similarity:144/414 - (34%) Gaps:147/414 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KLYDAVVAGDLKTMQEEMRKLVLQVDQPVKGGLNLLMLACREGHYKIVEWLLERAGANVN---RQ 104
            ||......|:|..:|.::......|:. |.||...|.:|..:||.::|::|: ..|||||   ::
Mosquito   434 KLVREAAQGNLDYVQSQLCMTPEAVNY-VSGGKTCLQVAAHQGHVELVKYLI-LMGANVNVVDKE 496

  Fly   105 LDS------------LMPLMMACN----------------TTHKDPCLAERIVGLLLRHGAVINV 141
            .||            :|.:::..|                :.||.|   ...|.:||..||.:|:
Mosquito   497 GDSTLHYAAFGNQPEVMRVLLQHNASIDELNSSHCSALHISAHKKP---PHCVKVLLEFGANVNM 558

  Fly   142 SEKYGMTPFMFACQNGFAGVVRLLIKDASFDAV--DNQGCTAIFHAIEK---------------- 188
            .:.||.|....|.......||.||....:.|..  :::|..|:.||..|                
Mosquito   559 QDAYGDTALHDAIGKENTEVVELLCSCPTLDLTIRNHRGFNALHHASLKGNVHAARHIIRLARQL 623

  Fly   189 ------------------NHVEVVKLLVEAG-ANATIANNKGYTPTQVAECHGYYDLLEILPRPA 234
                              .|..|:::||:.| |:..|.||:..||..:|...|:...:|.|..  
Mosquito   624 VNVRKDDGFAALHLTALNGHTRVIEVLVQEGQADINIRNNRSQTPFLLAVSQGHTAAIEKLVD-- 686

  Fly   235 STYLVPTHFLGY---------------------NTLRDHIPRIFLKSDCP---EYFQELNGILEA 275
                     ||.                     |.:.|..|     :|.|   :.:|.|.||:  
Mosquito   687 ---------LGADVRARDEDGDNAMHLCIIKKGNLVHDVSP-----TDAPKIHDIYQSLAGIV-- 735

  Fly   276 INIGNMVQYFAIARISLADFL---------------VMD---EQSLREIGIEYP---IFRHKILT 319
              |.:.:.|      :|..||               |:|   ...::||.:||.   :.|.....
Mosquito   736 --IEHRLMY------ALLCFLASEGCPLDVNRKGARVLDWIGSPQIKEIIVEYERTRLAREAAAA 792

  Fly   320 GILD---FHLHHWSNSSIARVKKD 340
            ...:   ||..|..|.:::....|
Mosquito   793 AAPNGPAFHPRHSPNRALSPAMGD 816

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaszNP_610362.1 Ank_2 44..141 CDD:289560 31/127 (24%)
ANK repeat 73..106 CDD:293786 13/35 (37%)
ANK 74..198 CDD:238125 41/190 (22%)
ANK repeat 110..143 CDD:293786 10/48 (21%)
Ank_2 111..208 CDD:289560 31/149 (21%)
ANK repeat 145..175 CDD:293786 9/31 (29%)
ANK repeat 177..208 CDD:293786 12/65 (18%)
SAM 273..324 CDD:197735 12/74 (16%)
SAM_superfamily 273..321 CDD:188886 12/68 (18%)
PHA03233 <289..>366 CDD:223016 15/76 (20%)
AgaP_AGAP008851XP_319593.4 MIB_HERC2 7..72 CDD:284184
ZZ_Mind_bomb 84..128 CDD:239079
MIB_HERC2 155..219 CDD:284184
ANK 464..582 CDD:238125 31/121 (26%)
ANK repeat 464..494 CDD:293786 12/30 (40%)
Ank_2 468..560 CDD:289560 24/95 (25%)
ANK repeat 496..527 CDD:293786 4/30 (13%)
ANK repeat 529..560 CDD:293786 9/33 (27%)
Ank_5 549..604 CDD:290568 16/54 (30%)
ANK 557..685 CDD:238125 29/127 (23%)
ANK repeat 562..594 CDD:293786 9/31 (29%)
ANK repeat 596..628 CDD:293786 5/31 (16%)
Ank_2 601..695 CDD:289560 20/104 (19%)
ANK repeat 630..662 CDD:293786 7/31 (23%)
ANK repeat 664..695 CDD:293786 8/41 (20%)
zf-C3HC4_3 910..953 CDD:290631
zf-C3HC4_3 987..1029 CDD:290631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X100
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.