| Sequence 1: | NP_610362.1 | Gene: | Gasz / 35795 | FlyBaseID: | FBgn0033273 | Length: | 461 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_308995.3 | Gene: | REL2 / 1270310 | VectorBaseID: | AGAP006747 | Length: | 1132 | Species: | Anopheles gambiae |
| Alignment Length: | 249 | Identity: | 57/249 - (22%) |
|---|---|---|---|
| Similarity: | 92/249 - (36%) | Gaps: | 85/249 - (34%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 46 DAVVAGDLKTMQEEMRKLVLQVDQPVKGG--------------------LNLLMLACREG----- 85
Fly 86 --------HYKIVEWLLERAGANVNRQLDSLMPLMMACNTTHKDPCLAERIVGLLLRHGAVINVS 142
Fly 143 EKYGMTPFMFACQNGFAGVVRLLIKDAS--FDAVDNQGCTAIFHAIEKNHVEVVKLLVEAGANAT 205
Fly 206 ------------IA------------------------NNKGYTPTQVAECHGY 223 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Gasz | NP_610362.1 | Ank_2 | 44..141 | CDD:289560 | 29/127 (23%) |
| ANK repeat | 73..106 | CDD:293786 | 11/65 (17%) | ||
| ANK | 74..198 | CDD:238125 | 34/158 (22%) | ||
| ANK repeat | 110..143 | CDD:293786 | 10/32 (31%) | ||
| Ank_2 | 111..208 | CDD:289560 | 30/134 (22%) | ||
| ANK repeat | 145..175 | CDD:293786 | 9/31 (29%) | ||
| ANK repeat | 177..208 | CDD:293786 | 11/66 (17%) | ||
| SAM | 273..324 | CDD:197735 | |||
| SAM_superfamily | 273..321 | CDD:188886 | |||
| PHA03233 | <289..>366 | CDD:223016 | |||
| REL2 | XP_308995.3 | RHD-n_Relish | 188..389 | CDD:143644 | |
| IPT_NFkappaB | 396..498 | CDD:238582 | |||
| Ank_2 | <741..814 | CDD:289560 | 20/84 (24%) | ||
| ANK repeat | 747..781 | CDD:293786 | 7/37 (19%) | ||
| ANK | 778..905 | CDD:238125 | 31/138 (22%) | ||
| ANK repeat | 783..814 | CDD:293786 | 10/38 (26%) | ||
| Ank_2 | 788..881 | CDD:289560 | 28/100 (28%) | ||
| ANK repeat | 816..881 | CDD:293786 | 18/64 (28%) | ||
| Ank_2 | 855..951 | CDD:289560 | 16/78 (21%) | ||
| ANK repeat | 919..951 | CDD:293786 | 6/14 (43%) | ||
| Death_NFkB-like | 1053..1124 | CDD:260024 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X100 | |
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||