Sequence 1: | NP_610362.1 | Gene: | Gasz / 35795 | FlyBaseID: | FBgn0033273 | Length: | 461 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_003436078.1 | Gene: | AgaP_AGAP002272 / 1269287 | VectorBaseID: | AGAP002272 | Length: | 2550 | Species: | Anopheles gambiae |
Alignment Length: | 297 | Identity: | 80/297 - (26%) |
---|---|---|---|
Similarity: | 125/297 - (42%) | Gaps: | 57/297 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 VDPEQK-LYDAV-VAGDLKTMQEEMRKLVL----QVDQPVKGGLNLLMLACREGHYKIVEWLLER 96
Fly 97 AGANVNRQ-LDSLMPLMMACNTTHKDPC----------------------LAER-----IVGLLL 133
Fly 134 RHGAVINVSEKYGMTPFMFACQNGFAGVVRLLIKD-ASFDAVDNQGCTAIFHAIEKNHVEVVKLL 197
Fly 198 VEAGANATIANNKGYTPTQVAECHGYYDLLEILPRP-----ASTYLVPTHFLGYNTLRD------ 251
Fly 252 -HIPRIFLKSDCPEYFQELNGILEAINIGNMVQYFAI 287 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gasz | NP_610362.1 | Ank_2 | 44..141 | CDD:289560 | 33/129 (26%) |
ANK repeat | 73..106 | CDD:293786 | 13/33 (39%) | ||
ANK | 74..198 | CDD:238125 | 38/152 (25%) | ||
ANK repeat | 110..143 | CDD:293786 | 11/59 (19%) | ||
Ank_2 | 111..208 | CDD:289560 | 29/124 (23%) | ||
ANK repeat | 145..175 | CDD:293786 | 9/30 (30%) | ||
ANK repeat | 177..208 | CDD:293786 | 9/30 (30%) | ||
SAM | 273..324 | CDD:197735 | 2/15 (13%) | ||
SAM_superfamily | 273..321 | CDD:188886 | 2/15 (13%) | ||
PHA03233 | <289..>366 | CDD:223016 | |||
AgaP_AGAP002272 | XP_003436078.1 | ANK repeat | 142..173 | CDD:293786 | |
Ank_4 | 143..196 | CDD:290365 | |||
ANK | 170..295 | CDD:238125 | |||
ANK repeat | 175..206 | CDD:293786 | |||
Ank_2 | 180..267 | CDD:289560 | |||
ANK repeat | 208..239 | CDD:293786 | |||
ANK repeat | 241..266 | CDD:293786 | |||
Ank_4 | 242..295 | CDD:290365 | |||
Ank_4 | 304..357 | CDD:290365 | |||
ANK repeat | 307..334 | CDD:293786 | |||
ANK | 331..456 | CDD:238125 | |||
ANK repeat | 336..367 | CDD:293786 | |||
Ank_2 | 341..432 | CDD:289560 | |||
ANK repeat | 369..400 | CDD:293786 | |||
ANK | 398..522 | CDD:238125 | |||
ANK repeat | 402..430 | CDD:293786 | |||
ANK repeat | 435..466 | CDD:293786 | |||
Ank_2 | 440..531 | CDD:289560 | |||
ANK repeat | 468..499 | CDD:293786 | |||
ANK | 496..621 | CDD:238125 | |||
ANK repeat | 501..532 | CDD:293786 | |||
Ank_5 | 521..575 | CDD:290568 | |||
ANK repeat | 534..565 | CDD:293786 | |||
ANK repeat | 567..598 | CDD:293786 | |||
Ank_2 | 572..663 | CDD:289560 | 12/37 (32%) | ||
ANK | 595..720 | CDD:238125 | 30/95 (32%) | ||
ANK repeat | 600..630 | CDD:293786 | 2/2 (100%) | ||
ANK repeat | 633..662 | CDD:293786 | 8/30 (27%) | ||
Ank_2 | 638..729 | CDD:289560 | 25/93 (27%) | ||
ANK | 661..786 | CDD:238125 | 33/125 (26%) | ||
ANK repeat | 666..697 | CDD:293786 | 12/31 (39%) | ||
ANK repeat | 699..728 | CDD:293786 | 4/28 (14%) | ||
Ank_2 | 704..795 | CDD:289560 | 20/90 (22%) | ||
ANK repeat | 732..762 | CDD:293786 | 7/29 (24%) | ||
ANK | 760..885 | CDD:238125 | 38/130 (29%) | ||
ANK repeat | 765..795 | CDD:293786 | 9/29 (31%) | ||
ANK repeat | 798..827 | CDD:293786 | 9/28 (32%) | ||
Ank_2 | 804..893 | CDD:289560 | 27/94 (29%) | ||
ANK repeat | 831..862 | CDD:293786 | 9/30 (30%) | ||
ANK repeat | 864..893 | CDD:293786 | 8/28 (29%) | ||
ZU5 | 1053..1155 | CDD:128514 | |||
Death_ank | 1547..1628 | CDD:260029 | |||
Ehrlichia_rpt | 1726..>2155 | CDD:118064 | |||
FtsN | <2253..2400 | CDD:225629 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |