| Sequence 1: | NP_610362.1 | Gene: | Gasz / 35795 | FlyBaseID: | FBgn0033273 | Length: | 461 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011520674.1 | Gene: | ANKS3 / 124401 | HGNCID: | 29422 | Length: | 668 | Species: | Homo sapiens |
| Alignment Length: | 238 | Identity: | 61/238 - (25%) |
|---|---|---|---|
| Similarity: | 99/238 - (41%) | Gaps: | 59/238 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 66 QVDQPVKGGLNLLMLACREGHYKIVEWLLERAGANVNRQL-DSLMPLMMACNTTHKDPCLAERIV 129
Fly 130 GLLLRHGAVINVSEKYGMTPFMFACQNGFAGVVRLLIKD-ASFDAVDNQGCTAIFHAIEKNHVEV 193
Fly 194 VKLLVEAGANATIANN-KGYTPTQVAECHGYYDLLEILPRPASTYLVPTHFLGYNT---LRDH-- 252
Fly 253 -------------------------IPRIFLKSDCPEYFQELN 270 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Gasz | NP_610362.1 | Ank_2 | 44..141 | CDD:289560 | 20/75 (27%) |
| ANK repeat | 73..106 | CDD:293786 | 7/33 (21%) | ||
| ANK | 74..198 | CDD:238125 | 37/125 (30%) | ||
| ANK repeat | 110..143 | CDD:293786 | 13/32 (41%) | ||
| Ank_2 | 111..208 | CDD:289560 | 34/97 (35%) | ||
| ANK repeat | 145..175 | CDD:293786 | 8/30 (27%) | ||
| ANK repeat | 177..208 | CDD:293786 | 13/30 (43%) | ||
| SAM | 273..324 | CDD:197735 | |||
| SAM_superfamily | 273..321 | CDD:188886 | |||
| PHA03233 | <289..>366 | CDD:223016 | |||
| ANKS3 | XP_011520674.1 | Ank_2 | 51..144 | CDD:289560 | 28/98 (29%) |
| ANK repeat | 51..78 | CDD:293786 | 7/26 (27%) | ||
| ANK | 75..201 | CDD:238125 | 43/144 (30%) | ||
| ANK repeat | 81..111 | CDD:293786 | 13/35 (37%) | ||
| ANK repeat | 113..144 | CDD:293786 | 8/30 (27%) | ||
| Ank_2 | 118..211 | CDD:289560 | 28/105 (27%) | ||
| ANK repeat | 146..176 | CDD:293786 | 13/29 (45%) | ||
| ANK repeat | 180..211 | CDD:293786 | 9/43 (21%) | ||
| SAM | 434..494 | CDD:197735 | |||
| SAM_ANKS3 | 436..499 | CDD:188918 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 97 | 1.000 | Inparanoid score | I5045 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.050 | |||||