DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RagC-D and rragd

DIOPT Version :9

Sequence 1:NP_610361.1 Gene:RagC-D / 35793 FlyBaseID:FBgn0033272 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001072896.1 Gene:rragd / 780358 XenbaseID:XB-GENE-490463 Length:396 Species:Xenopus tropicalis


Alignment Length:362 Identity:255/362 - (70%)
Similarity:294/362 - (81%) Gaps:10/362 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DDD-----DY-PADTFPKDFGYRAYNQDGLELEPNATGSSETKPRILLMGMRRSGKSSIQKVVFH 62
            |||     || ..|:|..  |.|....|...|:.....|:|.||||||||:||||||||||||||
 Frog    20 DDDIMGVSDYGDGDSFMD--GERGSEGDDEVLDFTDPFSTEVKPRILLMGLRRSGKSSIQKVVFH 82

  Fly    63 KMSPNETLFLESTSKIVKDDINNSSFVQFQIWDFPGQIDFFEPTFDSDMIFGGCGALVFVIDAKD 127
            |||||||||||||:||.::|::|||||.|||||||||||||:||||.:|||.|.|||:||||::|
 Frog    83 KMSPNETLFLESTNKICREDVSNSSFVNFQIWDFPGQIDFFDPTFDYEMIFRGTGALIFVIDSQD 147

  Fly   128 DYNEALTKFKNTVLQAYKVNKRIKFEVFIHKVDGISDDSKMESQRDIHQRSSDDLNEAGLDQIHL 192
            ||.|||.:...||..|||||..|.||||||||||:|||.|:|:|||||||::|||.:|||::|||
 Frog   148 DYMEALARLHLTVTSAYKVNPDINFEVFIHKVDGLSDDHKIETQRDIHQRANDDLVDAGLEKIHL 212

  Fly   193 SFHLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIFIPNSGIEKAFLFDVVSKIYIATDSSPVD 257
            ||:|||||||||||||||||||||||||||||||||||.||||||.|||||||||||||||||||
 Frog   213 SFYLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIFISNSGIEKVFLFDVVSKIYIATDSSPVD 277

  Fly   258 MQTYELCCDMIDVVIDLSSIYSSE--ETAFDSGSSSLIKLNNNTILYLREVNKFLALVCILREEN 320
            ||||||||||||||||:|.||..|  .|.:|..|.::|||||.|:|||:||.|||||||.:|||:
 Frog   278 MQTYELCCDMIDVVIDISCIYGLEGAGTPYDKESLAIIKLNNTTVLYLKEVTKFLALVCFVREES 342

  Fly   321 FNRQGVIDYNFICFRDAISEVFELRLKRQKQLENNDQ 357
            |.|:|:|||||.|||.||.||||:|:|..:..::..|
 Frog   343 FERKGLIDYNFHCFRKAIQEVFEVRVKVLRSRKHQSQ 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RagC-DNP_610361.1 RagC_like 42..216 CDD:206745 135/173 (78%)
rragdNP_001072896.1 RagC_like 62..236 CDD:206745 135/173 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 381 1.000 Domainoid score I830
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 491 1.000 Inparanoid score I1383
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1216811at2759
OrthoFinder 1 1.000 - - FOG0002298
OrthoInspector 1 1.000 - - otm47684
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R533
SonicParanoid 1 1.000 - - X1521
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.