DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8708 and AT1G33250

DIOPT Version :9

Sequence 1:NP_610360.2 Gene:CG8708 / 35792 FlyBaseID:FBgn0033271 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_174595.1 Gene:AT1G33250 / 840219 AraportID:AT1G33250 Length:548 Species:Arabidopsis thaliana


Alignment Length:255 Identity:49/255 - (19%)
Similarity:89/255 - (34%) Gaps:62/255 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 HDHRNDNVSVAEQLKKEVRILCWVMTNPTNHKKKARHVKRTWGK----RCNILL---FMSSGADE 134
            |:.||.::|..::|...:..|.:.:...:...::.:.:.|.|.|    |.::.|   ......|:
plant   114 HEFRNRSLSEIDKLDLSMNHLMFGIAGSSQLWERRKELVRLWWKPSQMRGHVWLEEQVSPEEGDD 178

  Fly   135 ELPTVKLDVGEGRENLWAKVKEAFKYV------------------YHHHYNDADFFYKADDDTYA 181
            .||.:.:.....|          |:|.                  :.....:..:|...||||..
plant   179 SLPPIIVSEDSSR----------FRYTNPTGHPSGLRISRIAMESFRLSLPNVRWFVLGDDDTIF 233

  Fly   182 VIENMRYMLYPYNPETPVHFGFKFKPFVKQGYMS-----GGAGYILS---REALRRFVVEGIPN- 237
            .:.|:..:|..|:|...|:.|...:......|.|     ||.|..:|   .|||.|...:.:.. 
plant   234 NVHNLLAVLSKYDPSEMVYIGNPSESHSANSYFSHNMAFGGGGIAISYPLAEALSRIHDDCLDRY 298

  Fly   238 PKMCLPGTVVNEDIEIGRCMENLNV------------TAGDSRDEIGRGRMFPFIPEHHL 285
            ||:      ...|..:..|:..|.|            ..|::...:....:.||:..||:
plant   299 PKL------YGSDDRLHACITELGVPLSREPGFHQWDIKGNAHGLLSSHPIAPFVSIHHV 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8708NP_610360.2 MIP-T3 <385..>449 CDD:287245
AT1G33250NP_174595.1 Galactosyl_T 17..548 CDD:304462 49/255 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X502
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.