DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8708 and AT5G57500

DIOPT Version :9

Sequence 1:NP_610360.2 Gene:CG8708 / 35792 FlyBaseID:FBgn0033271 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_200558.1 Gene:AT5G57500 / 835854 AraportID:AT5G57500 Length:318 Species:Arabidopsis thaliana


Alignment Length:241 Identity:52/241 - (21%)
Similarity:93/241 - (38%) Gaps:49/241 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LTEAPRSKNRSVFTLIAGLVVGYCLAQIFSSIAPHESLYPYLSRRFSDSQVATGGQLAPEQSGLK 76
            :..:|||:.|.........::..|:....:.|. .:||..:.....|:..:..|....|..|   
plant     1 MKSSPRSEGRKFIIPSFFFIIALCVLAFINEIR-FDSLLSFGRCALSNVPMNNGSSETPLLS--- 61

  Fly    77 HDHRNDNVSVAEQLKKEVRILCWVMTNPTNHKKKARHVKRTWGKRCNI---------LLFMSSGA 132
                      :..:..|:|||..::|.|..:.:  ||..|......|:         .:|.:...
plant    62 ----------SSPVDDEIRILIGILTLPDQYSR--RHFLRMIYGTQNVPDGVKVDVKFVFCNLTK 114

  Fly   133 DEELPTVKLDVGEGRE----NLWAKVKEAFKYVYHHH----YNDAD-------FFYKADDDTYAV 182
            :::...|.|::....:    |....:.:...|.|...    :|:.|       :..|||||||..
plant   115 EDQKVLVALEIMRYDDIIILNCNENMNKGKTYTYFSSLPDIFNETDAQKPPYHYVMKADDDTYIR 179

  Fly   183 IENMRYMLYPYNPETPVHFGF-----KFKPFVKQGYMSGGAGYILS 223
            :|::...|.|. |...:::|:     ...|||.  ||| |.||::|
plant   180 LESLVASLRPL-PREDLYYGYVIPCPSMDPFVH--YMS-GMGYLVS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8708NP_610360.2 MIP-T3 <385..>449 CDD:287245
AT5G57500NP_200558.1 Galactosyl_T 83..225 CDD:419759 34/145 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.