DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8708 and b3glcta

DIOPT Version :9

Sequence 1:NP_610360.2 Gene:CG8708 / 35792 FlyBaseID:FBgn0033271 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001289180.1 Gene:b3glcta / 799443 ZFINID:ZDB-GENE-110411-147 Length:496 Species:Danio rerio


Alignment Length:226 Identity:57/226 - (25%)
Similarity:89/226 - (39%) Gaps:35/226 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 EQLKKEVRILCWVMTNPTNHKKKARHVKRTWGKRCNILLFMSSGADEELPTVKLDVGEGRENLWA 152
            |.:|.| .|...|.|....|..:...||:||||:.::|.:.|..||..:||:.|.|.........
Zfish   263 EPVKIE-NIFVAVKTCKKFHSDRVPVVKKTWGKQASLLEYYSDYADPSIPTINLGVPNTERGHCG 326

  Fly   153 KVKEAFKYVYHHHYNDADFFYKADDDTYAVIENMRYMLYPYNPETPVHFGFKFKPFVKQG---YM 214
            |.....:.....|....|:....||||...:..::.:|..|....|:..|.::...:.||   |:
Zfish   327 KTFAILRRFLSSHVPRTDWLLIVDDDTLISLPRLQALLSCYESSEPLCLGERYGYGLGQGGYSYI 391

  Fly   215 SGGAGYILSREALRRFVVEGIPNPKMCLPGTVVNEDIEIGRCMENLNVTAGDS------------ 267
            :||.|.:.||||:.:.:..|........|     :|:.:|.|:.:|.|....|            
Zfish   392 TGGGGMLFSREAVVQLLSSGCNCYSNDAP-----DDMVLGMCLNSLRVPVTHSPLFHQARPEDYA 451

  Fly   268 RDEIGRGRMFPFIPEHHLIPAKADKNFWYWN 298
            ||.:.           |..|....|   :||
Zfish   452 RDFLS-----------HQTPISFHK---HWN 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8708NP_610360.2 MIP-T3 <385..>449 CDD:287245
b3glctaNP_001289180.1 Galactosyl_T 265..468 CDD:304462 54/222 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.