DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8708 and C1GALT1C1L

DIOPT Version :9

Sequence 1:NP_610360.2 Gene:CG8708 / 35792 FlyBaseID:FBgn0033271 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001094800.1 Gene:C1GALT1C1L / 728819 HGNCID:51617 Length:315 Species:Homo sapiens


Alignment Length:299 Identity:78/299 - (26%)
Similarity:138/299 - (46%) Gaps:52/299 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GQLAPEQSGLKHDH---------RNDNVSVAE----QLKKEVRILCWVMTNPTNHKKKARHVKRT 117
            ||:.....|...||         |||.::.::    :|.|.:|:.| ::...:..:.....:|.|
Human    27 GQIHIRHRGQTQDHEHHHLRPPNRNDFLNTSKVILLELSKSIRVFC-IIFGESEDESYWAVLKET 90

  Fly   118 WGKRCNILLFMSSGADEELPTVKLDVGEGRENL--------WAKVKEAFKYVYHHHYNDADFFYK 174
            |.|.|:         ..||...|.|      ||        |.:::.|:|||:..:.::.::|:.
Human    91 WTKHCD---------KAELYDTKND------NLFNIESNDRWVQMRTAYKYVFEKYGDNYNWFFL 140

  Fly   175 ADDDTYAVIENMRYMLYPYNPETPVHFGFKFKPFVKQGYMSGGAGYILSREALRRFVVEGIPNPK 239
            |...|:|||||::|:|:..:...|.:.|... .|....|::...|.:||||.::| :...:.|.:
Human   141 ALPTTFAVIENLKYLLFTRDASQPFYLGHTV-IFGDLEYVTVEGGIVLSRELMKR-LNRLLDNSE 203

  Fly   240 MCLPGTVV---NEDIEIGRCMENLNVTAGDSRDEIGRGRMFPFIPEHHLIPAKADKNFWYWNYLY 301
            .|...:|:   :||.::..|::...|.|.::.|..||. :|...|...||......|       .
Human   204 TCADQSVIWKLSEDKQLAICLKYAGVHAENAEDYEGRD-VFNTKPIAQLIEEALSNN-------P 260

  Fly   302 YKTDDGLDCCSDLAISFHYVAPNSFYVLDYLIYHLKPYG 340
            .:..:|  ||||:||:|:.:.|....|:.|.:|.|:.:|
Human   261 QQVVEG--CCSDMAITFNGLTPQKMEVMMYGLYRLRAFG 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8708NP_610360.2 MIP-T3 <385..>449 CDD:287245
C1GALT1C1LNP_001094800.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.