DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8708 and CG34451

DIOPT Version :9

Sequence 1:NP_610360.2 Gene:CG8708 / 35792 FlyBaseID:FBgn0033271 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster


Alignment Length:278 Identity:86/278 - (30%)
Similarity:132/278 - (47%) Gaps:34/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 RNDNVSVAEQLKKEVRILCWVMTNPTNHKKKARHVKRTWGKRCNILLFMSSGADEEL----PTVK 140
            :..|....:.|.:|:||||.:..| .|....|::|||||||.||:|||:|...|.||    |.: 
  Fly    36 KRSNQHTLDPLYEEIRILCMIPYN-YNSPDTAKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVI- 98

  Fly   141 LDVGEGRENLWAKVKEAFKYVYHHHYNDADFFYKADDDTYAVIENMRYMLY--PYNPETPVHFGF 203
                 ...:.|..|::.....|..:.:..|:|.:.:..::.|:||:|||::  .|.|..|::||:
  Fly    99 -----NSTDTWTLVQQGLMQAYLFYADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGY 158

  Fly   204 KFKPFV-KQGYMSGGAGYILSREALRRFVVEG-IPNPKMCLPGTVVNEDIEIGRCMENLNVTAGD 266
            :.:..| .:.::...:||::|||||||:.:.. .|..|.|.......|.::|.||:...|||..:
  Fly   159 ELENIVTHESFVHHHSGYVISREALRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAE 223

  Fly   267 SRDEIGRGRMFPFIPEHH-LIPAKADKNF--------WYWNYLYYKTDDGLDCCSDLAISFHYVA 322
            ||||.          ||. .:|...|..|        |.....|:|..:.....|..||.|....
  Fly   224 SRDEF----------EHETFLPVTMDYQFLNGYDTIPWLRKLSYHKRTEKTVPISSRAICFLVEY 278

  Fly   323 PNSFYVLDYLIYHLKPYG 340
            |...|...|.:|.||.:|
  Fly   279 PPEMYDYYYFVYRLKIFG 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8708NP_610360.2 MIP-T3 <385..>449 CDD:287245
CG34451NP_001369052.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.