DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8708 and b3glctb

DIOPT Version :9

Sequence 1:NP_610360.2 Gene:CG8708 / 35792 FlyBaseID:FBgn0033271 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001289177.1 Gene:b3glctb / 564156 ZFINID:ZDB-GENE-091204-128 Length:493 Species:Danio rerio


Alignment Length:176 Identity:44/176 - (25%)
Similarity:73/176 - (41%) Gaps:10/176 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LKKEVRILCWVMTNPTNHKKKARHVKRTWGKRCNILLFMSSGADEELPTVKLDVGEGRENLWAKV 154
            ||::|.:.  |.|....|:.:...||:||.|....|.:.|...|..:|||.|.|.........|.
Zfish   263 LKEDVFVA--VKTCQRFHRDRVPIVKQTWEKDAASLEYYSDVTDSIIPTVHLGVPNTERGHCEKT 325

  Fly   155 KEAFKYVYHHHYNDADFFYKADDDTYAVIENMRYMLYPYNPETPVHFGFKFKPFVKQ---GYMSG 216
            ....:.........|.:....||||...:..:|.:|..|:|...|..|.::...:.:   .|::|
Zfish   326 FAILRRFASGAVTQAPWLLIVDDDTLISLPRLRRLLSCYDPTEAVSVGERYGYGLSRDGYSYITG 390

  Fly   217 GAGYILSREALRRFVVEGIPNPKMCLPGTVVNEDIEIGRCMENLNV 262
            |.|.:.||.|::..:..|........|     :|:.:|.|:..|.:
Zfish   391 GGGMVFSRVAVQNILAGGCSCRSSDAP-----DDMVLGMCLTTLGL 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8708NP_610360.2 MIP-T3 <385..>449 CDD:287245
b3glctbNP_001289177.1 Galactosyl_T <121..>193 CDD:304462
Galactosyl_T 264..465 CDD:304462 43/175 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.