DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8708 and B3glct

DIOPT Version :9

Sequence 1:NP_610360.2 Gene:CG8708 / 35792 FlyBaseID:FBgn0033271 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_030110487.1 Gene:B3glct / 381694 MGIID:2685903 Length:582 Species:Mus musculus


Alignment Length:308 Identity:74/308 - (24%)
Similarity:111/308 - (36%) Gaps:82/308 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LKKEVRILCWVMTNPTNHKKKARHVKRTWGKRCNILLFMSSGADEELPTVKLDVGEGRENLWAKV 154
            :||| .|...|.|....|..:...||:||..:.:::.:.|..|:..:|||.|.:.........|.
Mouse   348 VKKE-EIFVAVKTCKKFHADRIPIVKKTWAAQASLIEYYSDYAETAIPTVDLGIPNTDRGHCGKT 411

  Fly   155 KEAFKYVYHHHYNDADFFYKADDDTYAVIENMRYMLYPYNPETPVHFGFKFKPFVKQG---YMSG 216
            ....:...:|.:|...:....||||...|..:|::|..|:...||..|.::...:..|   |::|
Mouse   412 FAILEKFLNHSHNKISWLVIVDDDTLISISRLRHLLSCYDSSDPVFLGERYGYGLGTGGYSYVTG 476

  Fly   217 GAGYILSREALRRFVVEGIPNPKMCLPGTVVNEDIEIGRCMENLNVTAGDSRDEIGRGRMFP--F 279
            |.|.:.||||:||.:|..      |             ||..|      |:.|::..|..|.  .
Mouse   477 GGGMVFSREAIRRLLVSS------C-------------RCYSN------DAPDDMVLGMCFSGLG 516

  Fly   280 IPEHHLIPAKADKNFWYWNYLYYKTDDGLDCCSDLAISFHYVAPNSFYVLDYLIYHLKPYGLLRS 344
            :|..|                           |.|   ||...|.. |..|||.:.: |....:.
Mouse   517 VPVTH---------------------------SPL---FHQARPVD-YPKDYLAHQI-PVSFHKH 549

  Fly   345 LEPLPAKLKVGQFLPPPVEARGRLASNEDSADDYDRIYTTTTEKPKEP 392
            ....|.|:.:....|          |.||.|         |.|..|:|
Mouse   550 WHIDPVKVYLTWLAP----------SEEDQA---------TQETQKDP 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8708NP_610360.2 MIP-T3 <385..>449 CDD:287245 4/8 (50%)
B3glctXP_030110487.1 Galactosyl_T 348..550 CDD:389837 63/259 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.