DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8708 and CG9109

DIOPT Version :9

Sequence 1:NP_610360.2 Gene:CG8708 / 35792 FlyBaseID:FBgn0033271 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001285650.1 Gene:CG9109 / 33844 FlyBaseID:FBgn0031765 Length:546 Species:Drosophila melanogaster


Alignment Length:359 Identity:75/359 - (20%)
Similarity:112/359 - (31%) Gaps:126/359 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RSLLTEAPRSKNRSVFTLIAGLVVGYCLAQIFSSIAPHESLY------PY------------LSR 55
            |.||.:..|...|.:      ...|:.|....::|..|.|.|      ||            |.|
  Fly   118 RGLLEQLRRQNPREL------AFYGHALYDAEATIIHHFSNYKDPQRFPYPMLSAGVVFTGALLR 176

  Fly    56 RFSDSQVATGGQLAPEQSGLKHDHRN-------DNVSVAEQ---------LKKEVRILCWVMTNP 104
            |.:| .||..||.....|....|..:       ||||....         |.|....:|...|:.
  Fly   177 RLAD-LVAPSGQNITVHSDFSIDASHELARFIFDNVSPDPHISTPISGGILLKSASYICSTPTSV 240

  Fly   105 TN------------------------------------------HKKKARHVKRTWGKRCNILLF 127
            .|                                          ||::...::|||........:
  Fly   241 PNRKLPCLLHAQPEEPLTLGQRRNGCEHTTGSHIYFAIKTCAKFHKERIPIIERTWAADARNRRY 305

  Fly   128 MSSGADEELPTVKLDVGEGREN------------LWAKVKEAFKYVYHHHYNDADFFYKADDDTY 180
            .|..||..:|.    :|.|..|            |...:|:..|.:      |..:....||||.
  Fly   306 YSDVADVGIPA----IGTGIPNVQTGHCAKTMAILQLSLKDIGKQL------DIRWLMLVDDDTL 360

  Fly   181 -----------AVIENMRYMLYPYNPETPVHFG--FKFKPFVKQG--YMSGGAGYILSREALRRF 230
                       ..:..:..:|..:|....|:.|  :.::.....|  |.:||||.:||. .|.|.
  Fly   361 LSLHLIHTHLPTSVPRVSALLCRHNATELVYLGQRYGYRLHAPDGFNYHTGGAGIVLSL-PLVRL 424

  Fly   231 VVEGIPNPKMCLPGTVVNEDIEIGRCMENLNVTA 264
            :|:....|....|     :|:.:|.|::.|.|.|
  Fly   425 IVQRCSCPSASAP-----DDMILGYCLQALGVPA 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8708NP_610360.2 MIP-T3 <385..>449 CDD:287245
CG9109NP_001285650.1 Fringe 269..486 CDD:190308 43/201 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.