DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8708 and tgy

DIOPT Version :9

Sequence 1:NP_610360.2 Gene:CG8708 / 35792 FlyBaseID:FBgn0033271 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001285425.1 Gene:tgy / 32896 FlyBaseID:FBgn0030984 Length:373 Species:Drosophila melanogaster


Alignment Length:369 Identity:148/369 - (40%)
Similarity:207/369 - (56%) Gaps:31/369 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TSASLLSRSLLTEAPR-SKNRSV--FTLIAGLVVGYCLAQIFSSIAPHESLYPYLSRRFSDSQVA 63
            :|::.|:..:...|.| |.:|.|  ..|::..|:|               |:.|.     |..|.
  Fly    19 SSSNGLANGMYRSAQRISTDRLVLLILLVSTTVIG---------------LFAYW-----DVMVL 63

  Fly    64 TGGQLAPEQSGLKHDHRND---NVSVAEQLKKEVRILCWVMTNPTNHKKKARHVKRTWGKRCNIL 125
            ..|.|...:.....|:...   |.::||::.:|||:||||:|.|..||.:|.||.||||||||.:
  Fly    64 NAGALPLSRGTSSVDYMEPGLRNETLAEKMHREVRVLCWVLTTPKYHKTRAIHVLRTWGKRCNKI 128

  Fly   126 LFMSSGADEELPTVKLDVGEGRENLWAKVKEAFKYVYHHHYNDADFFYKADDDTYAVIENMRYML 190
            .||:|..|:|||||.|...:..|.||.|.||||.:::....::||:|.|||||||..:||:||||
  Fly   129 YFMTSEPDDELPTVVLTKPDRYEMLWGKTKEAFVHIHEQMRHEADWFIKADDDTYLFLENLRYML 193

  Fly   191 YPYNPETPVHFGFKFKPF----VKQGYMSGGAGYILSREALRRFVVEGIPNPKMCLPGTVVNEDI 251
            |||:||||::|||.:|..    ..:.|||||:||:|||||||.| .||:.:...|.......||:
  Fly   194 YPYSPETPIYFGFNYKMVGTHQKNESYMSGGSGYVLSREALRIF-AEGVNDTTKCRQEDDHAEDV 257

  Fly   252 EIGRCMENLNVTAGDSRDEIGRGRMFPFIPEHHLIPAKADKNFWYWNYLYYKTDDGLDCCSDLAI 316
            |:|:|:.||.|.|||||||..|.|.:|..|...|:......:||.:.|.||.....:||.|:..:
  Fly   258 EMGKCLFNLGVKAGDSRDEQLRNRFYPIAPYGALLSGNVGMDFWLYKYAYYNPRSCMDCLSEYPV 322

  Fly   317 SFHYVAPNSFYVLDYLIYHLKPYGLLRSLEPLPAKLKVGQFLPP 360
            :||||.....||.||..|..:..|..:..|.||.|::..:.:.|
  Fly   323 AFHYVHSKQLYVYDYFNYQFQLSGRAQVAERLPKKIREEELVIP 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8708NP_610360.2 MIP-T3 <385..>449 CDD:287245
tgyNP_001285425.1 Galactosyl_T 103..>270 CDD:304462 87/167 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458873
Domainoid 1 1.000 173 1.000 Domainoid score I3636
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103727at6656
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.