DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8708 and C1galt1c1

DIOPT Version :9

Sequence 1:NP_610360.2 Gene:CG8708 / 35792 FlyBaseID:FBgn0033271 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001025204.1 Gene:C1galt1c1 / 302499 RGDID:1311230 Length:316 Species:Rattus norvegicus


Alignment Length:295 Identity:77/295 - (26%)
Similarity:143/295 - (48%) Gaps:59/295 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 EQSGLKHDHRNDNVSVAE----QLKKEVRILCWVMTNPTNHKKKARHVKRTWGKRCNILLFMSSG 131
            |...|:..:::|.:.::|    :|.|..::.|.|:..|.:....|. ||.||.|.|:...|.||.
  Rat    38 EHHHLQAPNKDDILKISETERMELSKSFQVYCIVLVKPKDVSLWAA-VKETWTKHCDKAEFFSSE 101

  Fly   132 ADEELPTVKLDVGEGRENLWAKVKEAFKYVYHHHYNDADFFYKADDDTYAVIENMRYMLYPYNPE 196
            ..:...::.:|..:    :|..:::|:||.|..:.:..::|:.|...|:|||||::|.|...:|.
  Rat   102 NVKVFESINMDTND----MWLMMRKAYKYAYDKYKDQYNWFFLARPTTFAVIENLKYFLLRKDPS 162

  Fly   197 TPVHFGFKFKPFVKQG---YMSGGAGYILSREALRRFVVEGIPN-PKMCLP---GTV--VNEDIE 252
            .|.:.|..    ||.|   |:|...|.:||.|:::|  :.|:.: |:.| |   |.:  ::||.:
  Rat   163 QPFYLGHT----VKSGDLEYVSVDGGIVLSIESMKR--LNGLLSVPEKC-PEQGGMIWKISEDKQ 220

  Fly   253 IGRCMENLNVTAGDSRDEIGRGRMFP------FIPE------HHLIPAKADKNFWYWNYLYYKTD 305
            :..|::...|.|.::.|..|:. :|.      ||.|      :.::..                 
  Rat   221 LAVCLKYAGVFAENAEDADGKD-VFNTKSVGLFIKEAMTNQPNQVVEG----------------- 267

  Fly   306 DGLDCCSDLAISFHYVAPNSFYVLDYLIYHLKPYG 340
                ||||:|::|:.:.||..:|:.|.:|.|:.:|
  Rat   268 ----CCSDMAVTFNGLTPNQMHVMMYGVYRLRAFG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8708NP_610360.2 MIP-T3 <385..>449 CDD:287245
C1galt1c1NP_001025204.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.