DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8708 and C1GALT1C1

DIOPT Version :9

Sequence 1:NP_610360.2 Gene:CG8708 / 35792 FlyBaseID:FBgn0033271 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001011551.1 Gene:C1GALT1C1 / 29071 HGNCID:24338 Length:318 Species:Homo sapiens


Alignment Length:311 Identity:77/311 - (24%)
Similarity:146/311 - (46%) Gaps:59/311 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 EQSGLKHDHRNDNVSVAE----QLKKEVRILCWVMTNPTNHKKKARHVKRTWGKRCNILLFMSSG 131
            |...|:..::.|.:.::|    :|.|..|:.|.::..|.:....|. ||.||.|.|:...|.||.
Human    40 EHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAA-VKETWTKHCDKAEFFSSE 103

  Fly   132 ADEELPTVKLDVGEGRENLWAKVKEAFKYVYHHHYNDADFFYKADDDTYAVIENMRYMLYPYNPE 196
            ..:...::.:|..:    :|..:::|:||.:..:.:..::|:.|...|:|:|||::|.|...:|.
Human   104 NVKVFESINMDTND----MWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPS 164

  Fly   197 TPVHFGFKFKPFVKQG---YMSGGAGYILSREALRRFVVEGIPN-PKMCLP---GTV--VNEDIE 252
            .|.:.|..    :|.|   |:....|.:||.|:::|  :..:.| |:.| |   |.:  ::||.:
Human   165 QPFYLGHT----IKSGDLEYVGMEGGIVLSVESMKR--LNSLLNIPEKC-PEQGGMIWKISEDKQ 222

  Fly   253 IGRCMENLNVTAGDSRDEIGR--------GRMFPFIPEHHLIPAKADKNFWYWNYLYYKTDDGLD 309
            :..|::...|.|.::.|..|:        |........:|  |.:..:.                
Human   223 LAVCLKYAGVFAENAEDADGKDVFNTKSVGLSIKEAMTYH--PNQVVEG---------------- 269

  Fly   310 CCSDLAISFHYVAPNSFYVLDYLIYHLKPYGLLRSLEPLPAKLKVGQFLPP 360
            ||||:|::|:.:.||..:|:.|.:|.|:.:|.:.: :.|       .||||
Human   270 CCSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHIFN-DAL-------VFLPP 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8708NP_610360.2 MIP-T3 <385..>449 CDD:287245
C1GALT1C1NP_001011551.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.