DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8708 and bus-22

DIOPT Version :10

Sequence 1:NP_610360.2 Gene:CG8708 / 35792 FlyBaseID:FBgn0033271 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_498472.2 Gene:bus-22 / 185403 WormBaseID:WBGene00303141 Length:272 Species:Caenorhabditis elegans


Alignment Length:38 Identity:12/38 - (31%)
Similarity:16/38 - (42%) Gaps:9/38 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 DNPVNADLVNSIQQNLQCCGKRSFLD-YGVASFPQSCC 164
            :.|..|||     |:|.   ..:.|| .|...||:..|
 Worm     7 EKPTKADL-----QDLM---NEADLDGDGTIDFPEFLC 36

Return to query results.
Submit another query.