DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8708 and C17A2.3

DIOPT Version :9

Sequence 1:NP_610360.2 Gene:CG8708 / 35792 FlyBaseID:FBgn0033271 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_494669.1 Gene:C17A2.3 / 182699 WormBaseID:WBGene00015871 Length:348 Species:Caenorhabditis elegans


Alignment Length:268 Identity:79/268 - (29%)
Similarity:124/268 - (46%) Gaps:28/268 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 GLKHDHRNDNVSVAEQLKKEVRILCWVMTNPTNHKKKARHVKRTWGKRCNILLFMSSGADEELP- 137
            |::|......:..:.|      |.|:|.|:...:|.:...|..||..||:...|.:.   ..|| 
 Worm    86 GIEHSPATFTLPTSGQ------IFCFVETSTKYYKDRVPSVASTWLPRCDHGRFFTK---THLPY 141

  Fly   138 ------TVKLDVGEGRENLWAKVKEAFKYVYHHHYNDADFFYKADDDTYAVIENMRYMLYPYNPE 196
                  ||..::.:..::|:.|...:..|.|.......|::.|.||||:..::::|..|...||.
 Worm   142 PDIAYSTVYRNLRDTYDDLFRKSIFSLYYSYTSISKHFDWYLKTDDDTFVAMDHLREYLNTLNPA 206

  Fly   197 TPVHFGFKFKPFVKQGYMSGGAGYILSREALRRFVVEGIPNPKMCLPGTVVNEDIEIGRCMENLN 261
            .|::.|::..||:..||.|||:|||||..|:|.||.:...|.::|....  .||..:|||:|::.
 Worm   207 EPLYLGYRLAPFMNNGYNSGGSGYILSNAAMRMFVEQLYHNVRLCPYDR--GEDRGMGRCLESVG 269

  Fly   262 VTAGDSRDEIGRGRMFPFIPEHHLIPAKADKNFWYWNYLYYKTDDGLDCCSDLAISFHYVAPNSF 326
            :|..|:||:....|..||.|..  ||....|    |:|...|    ....|...::.|.|.|...
 Worm   270 ITPSDTRDDQELNRFMPFRPAE--IPIIGSK----WHYFPLK----YPFISKKFVTLHRVPPEMM 324

  Fly   327 YVLDYLIY 334
            ..||..:|
 Worm   325 ISLDKSLY 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8708NP_610360.2 MIP-T3 <385..>449 CDD:287245
C17A2.3NP_494669.1 Galactosyl_T 98..>239 CDD:304462 45/149 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163248
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.800

Return to query results.
Submit another query.