DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8708 and ZC250.2

DIOPT Version :9

Sequence 1:NP_610360.2 Gene:CG8708 / 35792 FlyBaseID:FBgn0033271 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_504520.2 Gene:ZC250.2 / 178968 WormBaseID:WBGene00022576 Length:449 Species:Caenorhabditis elegans


Alignment Length:264 Identity:66/264 - (25%)
Similarity:104/264 - (39%) Gaps:63/264 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 EVRILCWVMTNPTNHKKKARHVKRTWGKRCNILLFMSSGADEELPTVKLDVGEGRENLWAKVKEA 157
            ||.::  |.|...:|..:...:|.||....:.:.:.|...|..:||:.|.|........||..|.
 Worm   226 EVHVM--VKTFEGHHVNRLEVLKNTWASDVSRIEYCSDKEDPAIPTINLGVDNTDRGHCAKTWEI 288

  Fly   158 FKYVYHHHYNDADFFYKADDDTYAVIENMRYMLYPYNPETPV----HFGFKFKPFVKQG--YMSG 216
            |:.......|.|.:...|||||....:.::.||..|:....:    .:|:.|......|  |.:|
 Worm   289 FRRFLGSSGNGAKWLVVADDDTLMNFKRLKQMLELYDSGDKIIIGERYGYGFSLNGDSGYDYPTG 353

  Fly   217 GAGYILSREALRRFVVEGIPNPKMCLPGTVVN---EDIEIGRCMENLNVTAG-----DSRDEIGR 273
            |:|.|.:|.|:...:.:       | |..:.|   :|:.||.|.    :|||     :||  :.:
 Worm   354 GSGMIFTRSAVESLLAQ-------C-PSCIANTDPDDMTIGICA----LTAGIPIVHESR--LHQ 404

  Fly   274 GRMFPFIPEHHLIPAKADKNFWYWNYLYYKTDDGLDCCSDLAISFHY---VAPNSFYVLDYLIYH 335
            .|...:.||                |:.|            .||||.   :.|.|.| .:||: .
 Worm   405 ARPLDYAPE----------------YIKY------------PISFHKFTDIDPISVY-YEYLV-E 439

  Fly   336 LKPY 339
            |:.|
 Worm   440 LEEY 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8708NP_610360.2 MIP-T3 <385..>449 CDD:287245
ZC250.2NP_504520.2 Galactosyl_T 231..424 CDD:304462 57/234 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.