DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8708 and B3GLCT

DIOPT Version :9

Sequence 1:NP_610360.2 Gene:CG8708 / 35792 FlyBaseID:FBgn0033271 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_919299.3 Gene:B3GLCT / 145173 HGNCID:20207 Length:498 Species:Homo sapiens


Alignment Length:239 Identity:51/239 - (21%)
Similarity:96/239 - (40%) Gaps:28/239 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KKEVRILCWVMTNPTNHKKKARHVKRTWGKRCNILLFMSSGADEELPTVKLDVGEGRENLWAKVK 155
            ||::.:.  |.|....|..:...||:||..:.:::.:.|...:..:|||.|.:.........|..
Human   266 KKDIFVA--VKTCKKFHGDRIPIVKQTWESQASLIEYYSDYTENSIPTVDLGIPNTDRGHCGKTF 328

  Fly   156 EAFKYVYHHHYNDADFFYKADDDTYAVIENMRYMLYPYNPETPVHFGFKFKPFVKQG---YMSGG 217
            ...:...:...:...:....||||...|..::::|..|:...||..|.::...:..|   |::||
Human   329 AILERFLNRSQDKTAWLVIVDDDTLISISRLQHLLSCYDSGEPVFLGERYGYGLGTGGYSYITGG 393

  Fly   218 AGYILSREALRRFVVEGIPNPKMCLPGTVVNEDIEIGRCMENLNVTAGDSRDEIGRGRMFPFIPE 282
            .|.:.||||:||.:..     |.........:|:.:|.|...|.:....| ....:.|...:..:
Human   394 GGMVFSREAVRRLLAS-----KCRCYSNDAPDDMVLGMCFSGLGIPVTHS-PLFHQARPVDYPKD 452

  Fly   283 H--HLIPAKADKNFWYWNYLYYKTDDGLDCCSDLAISFHYVAPN 324
            :  |.:|....|   :||            ...:.:.|.::||:
Human   453 YLSHQVPISFHK---HWN------------IDPVKVYFTWLAPS 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8708NP_610360.2 MIP-T3 <385..>449 CDD:287245
B3GLCTNP_919299.3 Galactosyl_T 264..467 CDD:304462 46/211 (22%)
Prevents secretion from ER 495..498
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.