DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lpin and Pitpnc1

DIOPT Version :9

Sequence 1:NP_001188884.1 Gene:Lpin / 35790 FlyBaseID:FBgn0263593 Length:1089 Species:Drosophila melanogaster
Sequence 2:NP_001346545.1 Gene:Pitpnc1 / 71795 MGIID:1919045 Length:332 Species:Mus musculus


Alignment Length:61 Identity:17/61 - (27%)
Similarity:26/61 - (42%) Gaps:8/61 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 AAGGRPSTPIQSDS-ELETTMRDNRHVVTEESTASWKWGELPTPEQAKNEAMSAAQVQQSE 456
            |....||||:.:|: |..:..:|.....:...|.:     ||.||  |...::...|..||
Mouse   271 APSSAPSTPLSTDAPEFLSIPKDRPRKKSAPETLT-----LPDPE--KKATLNLPGVYTSE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LpinNP_001188884.1 Lipin_N 1..103 CDD:282436
Lipin_mid 562..671 CDD:293481
LNS2 760..985 CDD:285447
Pitpnc1NP_001346545.1 SRPBCC_PITPNC1_like 2..250 CDD:176899
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..332 16/60 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5083
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.