DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lpin and Pitpnc1

DIOPT Version :10

Sequence 1:NP_610359.2 Gene:Lpin / 35790 FlyBaseID:FBgn0263593 Length:1089 Species:Drosophila melanogaster
Sequence 2:NP_001346545.1 Gene:Pitpnc1 / 71795 MGIID:1919045 Length:332 Species:Mus musculus


Alignment Length:202 Identity:37/202 - (18%)
Similarity:62/202 - (30%) Gaps:63/202 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   725 SDSLVNAENTSALVDNLE-ELTMASNKSDEPKERYKKS----LRLSSAAIKKLNLKEGMNEIEFS 784
            :||:.::|     ..:|| |:.......||..|||.|.    ....|....:..|:||       
Mouse   120 NDSIFDSE-----AKDLEREVCFIDIACDEIPERYYKESEDPKHFKSEKTGRGQLREG------- 172

  Fly   785 VTTAYQGTTRCKCYLFRWKHNDKVVISDIDGTITKSDVLG------HILPMVGKDWAQLGVAQLF 843
                             |:.|.:.::........|.:|.|      ..:..|.:|...:|..|.|
Mouse   173 -----------------WRDNHQPIMCSYKLVTVKFEVWGLQTRVEQFVHKVVRDILLIGHRQAF 220

  Fly   844 SKIEQNGYKLLYLSARAIGQSRVTREYLR--------------------SIRQGNVMLPDGPLLL 888
            :.::: .|.:.....|..  .|.|:|...                    |:|......|..||..
Mouse   221 AWVDE-WYDMTMDEVREF--ERATQEATNKKIGVFPPAISISSIALLPSSVRSAPSSAPSTPLST 282

  Fly   889 NPTSLIS 895
            :....:|
Mouse   283 DAPEFLS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LpinNP_610359.2 Lipin_N 1..104 CDD:461356
Lipin_mid 562..674 CDD:465292
LNS2 760..985 CDD:462403 26/166 (16%)
Pitpnc1NP_001346545.1 SRPBCC_PITPNC1_like 2..250 CDD:176899 31/161 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..332 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.