DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lpin and PITPNA

DIOPT Version :10

Sequence 1:NP_610359.2 Gene:Lpin / 35790 FlyBaseID:FBgn0263593 Length:1089 Species:Drosophila melanogaster
Sequence 2:NP_006215.1 Gene:PITPNA / 5306 HGNCID:9001 Length:270 Species:Homo sapiens


Alignment Length:68 Identity:17/68 - (25%)
Similarity:34/68 - (50%) Gaps:9/68 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 LSEKLKEFTTQKIRQEWAE-HEELFQGEKKPADSDSLDNQSKASNEAETEKAIPAVIEDTEKEKD 250
            |..|::.|..::.|:.:.. |.:||....|..|. ::|:..:.  |.||::.:     |..::||
Human   205 LQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDL-TMDDIRRM--EEETKRQL-----DEMRQKD 261

  Fly   251 QIK 253
            .:|
Human   262 PVK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LpinNP_610359.2 Lipin_N 1..104 CDD:461356
Lipin_mid 562..674 CDD:465292
LNS2 760..985 CDD:462403
PITPNANP_006215.1 SRPBCC_PITPNA-B_like 3..259 CDD:176897 14/61 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..270 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.