Sequence 1: | NP_001188884.1 | Gene: | Lpin / 35790 | FlyBaseID: | FBgn0263593 | Length: | 1089 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005157947.1 | Gene: | pitpnc1b / 492803 | ZFINID: | ZDB-GENE-041114-158 | Length: | 305 | Species: | Danio rerio |
Alignment Length: | 260 | Identity: | 46/260 - (17%) |
---|---|---|---|
Similarity: | 81/260 - (31%) | Gaps: | 94/260 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 EFQCS---PFHVRFGKLGVLRSREKVVDIEINGVPVDIQMKLGDSGEAFFVEECLED--EDEELP 97
Fly 98 ------ANLATSPIPNSFLASRDKANDTMEDISGVVTDKNASEELLLPLPLPRRNSIDFSKEEPK 156
Fly 157 EAVVEGSK---------FENQVSDYTQRRHTD------------------NTLER-RNLSEKLKE 193
Fly 194 FTTQKIRQEWAEHEELFQGEKKPADSDSLDNQSKASNEAETEKAIPAVIEDTEKEKDQIKPDVNL 258
Fly 259 258 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lpin | NP_001188884.1 | Lipin_N | 1..103 | CDD:282436 | 12/75 (16%) |
Lipin_mid | 562..671 | CDD:293481 | |||
LNS2 | 760..985 | CDD:285447 | |||
pitpnc1b | XP_005157947.1 | SRPBCC | 2..249 | CDD:301327 | 36/200 (18%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5083 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |