DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lpin and Pitpna

DIOPT Version :9

Sequence 1:NP_001188884.1 Gene:Lpin / 35790 FlyBaseID:FBgn0263593 Length:1089 Species:Drosophila melanogaster
Sequence 2:NP_032876.1 Gene:Pitpna / 18738 MGIID:99887 Length:271 Species:Mus musculus


Alignment Length:38 Identity:13/38 - (34%)
Similarity:17/38 - (44%) Gaps:5/38 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1013 DDYDV----DVEHGSSEESSGDEDDDEALYNDDFANDD 1046
            |:|.|    .|...|..|:.|.| ..|.|.|:.:..||
Mouse    16 DEYQVGQLYSVAEASKNETGGGE-GVEVLVNEPYEKDD 52

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LpinNP_001188884.1 Lipin_N 1..103 CDD:282436
Lipin_mid 562..671 CDD:293481
LNS2 760..985 CDD:285447
PitpnaNP_032876.1 SRPBCC_PITPNA-B_like 3..260 CDD:176897 13/38 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 251..271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5083
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.