DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp44a and Obp99b

DIOPT Version :9

Sequence 1:NP_001286186.1 Gene:Obp44a / 35789 FlyBaseID:FBgn0033268 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001263078.1 Gene:Obp99b / 43497 FlyBaseID:FBgn0039685 Length:149 Species:Drosophila melanogaster


Alignment Length:146 Identity:51/146 - (34%)
Similarity:76/146 - (52%) Gaps:11/146 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILLCALLGLASA--------SDYKLRTAEDLQSARKECAASSKVTEALIAKYKTFDYPDDDITRN 63
            :|:..|||||..        .||.::|.|||.:.|.:|......:|.|:.|||.:.||||.:|..
  Fly     3 VLIVLLLGLAFVLADHHHHHHDYVVKTHEDLTNYRTQCVEKVHASEELVEKYKKWQYPDDAVTHC 67

  Fly    64 YIQCIFVKFDLFDEAKGFKVENLVAQL-GQGKE--DKAALKADIEKCADKNEQKSPANEWAFRGF 125
            |::|||.||..:|...||.|..:..|| |.|.|  :...:...|..||:.:.::..:...|:...
  Fly    68 YLECIFQKFGFYDTEHGFDVHKIHIQLAGPGVEVHESDEVHQKIAHCAETHSKEGDSCSKAYHAG 132

  Fly   126 KCFLGKNLPLVQAAVQ 141
            .||:..||.|||.:|:
  Fly   133 MCFMNSNLQLVQHSVK 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp44aNP_001286186.1 PhBP 32..132 CDD:214783 33/102 (32%)
Obp99bNP_001263078.1 PBP_GOBP 24..137 CDD:396118 39/112 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450210
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FBJK
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26884
OrthoDB 1 1.010 - - D93539at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.