DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp44a and Obp99c

DIOPT Version :9

Sequence 1:NP_001286186.1 Gene:Obp44a / 35789 FlyBaseID:FBgn0033268 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_651711.1 Gene:Obp99c / 43494 FlyBaseID:FBgn0039682 Length:151 Species:Drosophila melanogaster


Alignment Length:129 Identity:37/129 - (28%)
Similarity:69/129 - (53%) Gaps:4/129 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VAILLCALLGLASASDYKLRTAEDLQSARKECAASSKVTEALIAKYKTFDYPDDDITRNYIQCIF 69
            ||:.|||   :|.|.|:..:|.|:::..|.:|...:.::...|::.|...:|::...|.|:.|..
  Fly     7 VALALCA---VAHADDWTPKTGEEIRKIRVDCLKENPLSNDQISQLKNLIFPNEPDVRQYLTCSA 68

  Fly    70 VKFDLFDEAKGFKVENLVAQLGQGKEDKAALKADIEKCADKNEQKSPANEWAFRGFKCFLGKNL 133
            :|..:|.:.:|:..:.|..|......::.||:. .:.|.|.|.||:|.:.|||||.:|.:...:
  Fly    69 IKLGIFCDQQGYHADRLAKQFKMDLSEEEALQI-AQSCVDDNAQKNPTDVWAFRGHQCMMASKI 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp44aNP_001286186.1 PhBP 32..132 CDD:214783 27/99 (27%)
Obp99cNP_651711.1 PBP_GOBP 17..128 CDD:279703 31/111 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450215
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105360at50557
OrthoFinder 1 1.000 - - FOG0009982
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.