DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp44a and Obp99a

DIOPT Version :9

Sequence 1:NP_001286186.1 Gene:Obp44a / 35789 FlyBaseID:FBgn0033268 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001287586.1 Gene:Obp99a / 43488 FlyBaseID:FBgn0039678 Length:142 Species:Drosophila melanogaster


Alignment Length:141 Identity:62/141 - (43%)
Similarity:84/141 - (59%) Gaps:4/141 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKNAVAILLCALLGLASASDYKLRTAEDLQSARKECAASSKVTEALIAKYKTFDYPDDDITRNYI 65
            ||..|||  |.|:||||| ||.::...|:.:.|.||.....|...|:.||:.::||:|..|:.||
  Fly     1 MKVFVAI--CVLIGLASA-DYVVKNRHDMLAYRDECVKELAVPVDLVEKYQKWEYPNDAKTQCYI 62

  Fly    66 QCIFVKFDLFDEAKGFKVENLVAQL-GQGKEDKAALKADIEKCADKNEQKSPANEWAFRGFKCFL 129
            :|:|.|:.|||...||.|||:..|| |...:...|..|.:..|.|||||.|.|.|||:||..|.|
  Fly    63 KCVFTKWGLFDVQSGFNVENIHQQLVGNHADHNEAFHASLAACVDKNEQGSNACEWAYRGATCLL 127

  Fly   130 GKNLPLVQAAV 140
            .:||..:|.::
  Fly   128 KENLAQIQKSL 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp44aNP_001286186.1 PhBP 32..132 CDD:214783 44/100 (44%)
Obp99aNP_001287586.1 PhBP 29..130 CDD:214783 44/100 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450211
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FBJK
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26884
OrthoDB 1 1.010 - - D105360at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.